KEGG   Homo sapiens (human): 9019Help
Entry
9019              CDS       T01001                                 

Gene name
MPZL1, MPZL1b, PZR, PZR1b, PZRa, PZRb
Definition
(RefSeq) myelin protein zero like 1
  KO
K06770  
myelin protein zero
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9019 (MPZL1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   N/0 subfamily
    MPZ; myelin protein zero [KO:K06770]
     9019 (MPZL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O95297(Tbio)
UniProt: 
Position
1q24.2
AA seq 269 aa AA seqDB search
MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKF
KSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASI
NIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLT
LLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVI
YAQLDHSGGHHSDKINKSESVVYADIRKN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtccgccggagccggggcggtgattgcagccccagacagccggcgctggctg
tggtcggtgctggcggcggcgcttgggctcttgacagctggagtatcagccttggaagta
tatacgccaaaagaaatcttcgtggcaaatggtacacaagggaagctgacctgcaagttc
aagtctactagtacgactggcgggttgacctcagtctcctggagcttccagccagagggg
gccgacactactgtgtcgtttttccactactcccaagggcaagtgtaccttgggaattat
ccaccatttaaagacagaatcagctgggctggagaccttgacaagaaagatgcatcaatc
aacatagaaaatatgcagtttatacacaatggcacctatatctgtgatgtcaaaaaccct
cctgacatcgttgtccagcctggacacattaggctctatgtcgtagaaaaagagaatttg
cctgtgtttccagtttgggtagtggtgggcatagttactgctgtggtcctaggtctcact
ctgctcatcagcatgattctggctgtcctctatagaaggaaaaactctaaacgggattac
actggctgcagtacatcagagagtttgtcaccagttaagcaggctcctcggaagtccccc
tccgacactgagggtcttgtaaagagtctgccttctggatctcaccagggcccagtcata
tatgcacagttagaccactccggcggacatcacagtgacaagattaacaagtcagagtct
gtggtgtatgcggatatccgaaagaattaa

DBGET integrated database retrieval system