KEGG   Homo sapiens (human): 9021Help
Entry
9021              CDS       T01001                                 

Gene name
SOCS3, ATOD4, CIS3, Cish3, SOCS-3, SSI-3, SSI3
Definition
suppressor of cytokine signaling 3
Orthology
K04696  
suppressor of cytokine signaling 3
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Osteoclast differentiation
Jak-STAT signaling pathway
TNF signaling pathway
Insulin signaling pathway
Prolactin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Influenza A
Herpes simplex infection
Module
ECS complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:hsa04917]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hsa04930]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.3
AA seq 225 aa AA seqDB search
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgcagtgaccggcggcgaggcgaacctgctgctc
agtgccgagcccgccggcacctttctgatccgcgacagctcggaccagcgccacttcttc
acgctcagcgtcaagacccagtctgggaccaagaacctgcgcatccagtgtgaggggggc
agcttctctctgcagagcgatccccggagcacgcagcccgtgccccgcttcgactgcgtg
ctcaagctggtgcaccactacatgccgccccctggagccccctccttcccctcgccacct
actgaaccctcctccgaggtgcccgagcagccgtctgcccagccactccctgggagtccc
cccagaagagcctattacatctactccgggggcgagaagatccccctggtgttgagccgg
cccctctcctccaacgtggccactcttcagcatctctgtcggaagaccgtcaacggccac
ctggactcctatgagaaagtcacccagctgccggggcccattcgggagttcctggaccag
tacgatgccccgctttaa

DBGET integrated database retrieval system