KEGG   Homo sapiens (human): 9021Help
Entry
9021              CDS       T01001                                 

Gene name
SOCS3, ATOD4, CIS3, Cish3, SOCS-3, SSI-3, SSI3
Definition
suppressor of cytokine signaling 3
Orthology
K04696  
suppressor of cytokine signaling 3
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Osteoclast differentiation
Jak-STAT signaling pathway
TNF signaling pathway
Insulin signaling pathway
Prolactin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Influenza A
Herpes simplex infection
Module
ECS complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9021 (SOCS3)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    9021 (SOCS3)
   04668 TNF signaling pathway
    9021 (SOCS3)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    9021 (SOCS3)
   04920 Adipocytokine signaling pathway
    9021 (SOCS3)
   04917 Prolactin signaling pathway
    9021 (SOCS3)
  Development
   04380 Osteoclast differentiation
    9021 (SOCS3)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    9021 (SOCS3)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    9021 (SOCS3)
  Infectious diseases
   05164 Influenza A
    9021 (SOCS3)
   05160 Hepatitis C
    9021 (SOCS3)
   05168 Herpes simplex infection
    9021 (SOCS3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   ECS complex
    target recognizing subunit (SOCS box)
     9021 (SOCS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.3
AA seq 225 aa AA seqDB search
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgcagtgaccggcggcgaggcgaacctgctgctc
agtgccgagcccgccggcacctttctgatccgcgacagctcggaccagcgccacttcttc
acgctcagcgtcaagacccagtctgggaccaagaacctgcgcatccagtgtgaggggggc
agcttctctctgcagagcgatccccggagcacgcagcccgtgccccgcttcgactgcgtg
ctcaagctggtgcaccactacatgccgccccctggagccccctccttcccctcgccacct
actgaaccctcctccgaggtgcccgagcagccgtctgcccagccactccctgggagtccc
cccagaagagcctattacatctactccgggggcgagaagatccccctggtgttgagccgg
cccctctcctccaacgtggccactcttcagcatctctgtcggaagaccgtcaacggccac
ctggactcctatgagaaagtcacccagctgccggggcccattcgggagttcctggaccag
tacgatgccccgctttaa

DBGET integrated database retrieval system