KEGG   Homo sapiens (human): 9023Help
Entry
9023              CDS       T01001                                 

Gene name
CH25H, C25H
Definition
(RefSeq) cholesterol 25-hydroxylase
  KO
K10223  
cholesterol 25-hydroxylase [EC:1.14.99.38]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00120 Primary bile acid biosynthesis
    9023 (CH25H)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.38  cholesterol 25-hydroxylase
     9023 (CH25H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O95992(Tbio)
UniProt: 
Position
10q23.31
AA seq 272 aa AA seqDB search
MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDI
LCSWVPALRRYKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPE
LLLLLHHILFCLLLFDMEFFVWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELF
SLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHD
LHHSHFNCNFAPYFTHWDKILGTLRTASVPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagctgccacaactgctccgacccccaggtcctttgcagctccgggcagctgttcctg
cagcccctctgggaccacctgaggagctgggaggccctcctacagtcgcccttcttcccg
gtcatcttctccatcaccacatacgtgggcttttgcctgcccttcgtggtcctggatatc
ctgtgctcctgggtgcccgccctgcggcgctacaagatccaccctgacttctcgccatcc
gcgcagcagctgctaccttgcctggggcagaccctctaccagcatgtgatgtttgtgttc
cccgtgacgctgctgcattgggcccgcagcccggccctcctgccccacgaagctcccgag
ctgctcctgctgctgcaccacatcctgttctgcctgctactcttcgacatggagttcttc
gtgtggcacctgctgcaccacaaggtgccctggctgtaccgcaccttccacaaggtgcac
caccagaactcgtcctcgttcgcgctggcaacgcagtatatgagcgtctgggaactgttt
tctttgggcttcttcgacatgatgaacgtcacactgctcgggtgccacccgctcaccacc
ctgaccttccacgtggtcaacatctggctttccgtggaggaccactccggctacaacttc
ccttggtccactcacagactggtgcccttcgggtggtacgggggtgtggtgcaccacgac
ctgcatcactctcactttaactgcaacttcgctccgtactttacacactgggacaaaata
ctgggaacgctgcggactgcatctgtcccagcgcggtga

DBGET integrated database retrieval system