KEGG   Homo sapiens (human): 90231Help
Entry
90231             CDS       T01001                                 

Definition
KIAA2013
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.22
AA seq 634 aa AA seqDB search
MWLQQRLKGLPGLLSSSWARRLLCLLGLLLLLLWFGGSGARRAAGGLHLLPWSRGEPGAA
EPSACLEAATRAWRGLRERGEVVPLGPGVPALVANGFLALDVAANRLWVTPGEREPAVAP
DFVPFVQLRPLSALAEAGEAVLLLREGLLRRVRCLQLGSPGPGPVAAGPGPASVSGLAAG
SGRDCVLLQEDFLAHRGRPHVYLQRIQLNNPTERVAALQTVGPTAGPAPKAFTSTLEKVG
DHQFLLYSGRSPPTPTGLVHLVVVAAKKLVNRLQVAPKTQLDETVLWVVHVSGPINPQVL
KSKAAKELKALQDLARKEMLELLDMPAAELLQDHQLLWAQLFSPGVEMKKITDTHTPSGL
TVNLTLYYMLSCSPAPLLSPSLSHRERDQMESTLNYEDHCFSGHATMHAENLWPGRLSSV
QQILQLSDLWRLTLQKRGCKGLVKVGAPGILQGMVLSFGGLQFTENHLQFQADPDVLHNS
YALHGIRYKNDHINLAVLADAEGKPYLHVSVESRGQPVKIYACKAGCLDEPVELTSAPTG
HTFSVMVTQPITPLLYISTDLTHLQDLRHTLHLKAILAHDEHMAQQDPGLPFLFWFSVAS
LITLFHLFLFKLIYNEYCGPGAKPLFRSKEDPSV
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgcagcagcggctcaaggggctgccgggactgctgtcgagcagctgggcccgc
cgcctcctctgcctgcttggcctcctgctgctgcttctgtggtttggggggtccggcgcg
cggcgggcggcgggcggcctgcacctgctgccctggtcccgcggtgagccgggcgccgcc
gagccgtctgcctgcctggaggcggccacccgcgcctggcgcggcctgcgggagcgcggt
gaggtggtaccgctgggtcctggagtgccggccctggtggccaacggcttcctggccctg
gacgtggctgccaatcggctgtgggtgactcccggggagcgggagcccgccgtggcgccg
gactttgtgcccttcgtgcagctgcgcccgctgagcgcgctggctgaagctggagaggcg
gtgctgctgctgcgggaggggcttctgcgccgcgtgcgttgcctgcagctggggtcccca
ggtcctggccccgtggccgccggccccgggcccgcctccgtctctggccttgccgcgggg
tccggccgcgactgcgtgctgctgcaagaggactttctggcgcacaggggccgaccccac
gtctacctgcagcgcatccagctcaacaaccccacggagcgcgtggccgcgctgcagact
gtggggcccactgccggcccagcccccaaggccttcaccagtaccctggagaaggtcgga
gaccatcagttcctcctctactcaggccggtccccgcctacgcccactgggttggtgcac
ctggtggtggtggccgccaagaagctggtgaaccgcctccaagtggctcccaagacgcag
ctggatgagacggtgctgtgggtggtgcacgtctctggccccattaacccccaggtgctc
aaaagcaaagcagccaaggagctcaaggcgctgcaggacttggcacggaaggaaatgctg
gagctcttggacatgccagcggcggagctgcttcaagaccaccagctcctctgggctcag
ctcttcagcccaggagtggaaatgaagaagatcactgacacccacacgccgtctggcctc
accgtgaacctgacgctctattacatgctctcctgctcgccagccccactgctcagcccc
tccctgagccacagggagcgagaccagatggagtcgacgctcaactatgaagatcactgc
ttcagcgggcacgccaccatgcacgccgagaacctgtggccggggcggctgtcctccgtc
cagcagatcctgcagctctctgacctgtggaggctgaccctccagaagcgtggctgcaag
gggctggtgaaggtgggtgccccaggcatcctgcaggggatggtgctcagctttgggggg
ctgcagttcacagagaaccacctccagttccaggccgaccccgacgtgctgcacaacagc
tatgcattgcatggcatccgctacaagaacgaccatatcaacctggccgtgctggcggat
gccgagggcaagccctacctacacgtgtccgtggagtcccgtggccagcctgtcaagatc
tatgcctgcaaggcaggctgcctggacgagccagtggagctgacctcggcgcccacgggc
cacaccttctcggtcatggtgacacagcccatcacgccactgctctacatctccaccgac
ctcacacacctgcaggacctgcggcacacgctgcacctcaaggccatcctggcccatgat
gagcacatggcccagcaggaccccgggctgcccttcctcttctggttcagcgtggcctcc
ctaatcaccctcttccacctcttcctcttcaagctcatctacaacgagtactgtgggcct
ggagccaagcccctcttcaggagtaaggaagatcccagtgtctga

DBGET integrated database retrieval system