KEGG   Homo sapiens (human): 9024Help
Entry
9024              CDS       T01001                                 

Gene name
BRSK2, C11orf7, PEN11B, SAD1, SADA, STK29
Definition
(RefSeq) BR serine/threonine kinase 2 (EC:2.7.11.1 2.7.11.26)
  KO
K08796  
BR serine/threonine kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9024 (BRSK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   9024 (BRSK2)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     9024 (BRSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.5
AA seq 736 aa AA seqDB search
MTSTGKDGGAQHAQYVGPYRLEKTLGKGQTGLVKLGVHCVTCQKVAIKIVNREKLSESVL
MKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARK
FFRQIISALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVGDSLLETSCGSPH
YACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRQLLEKVKRGVFHMPHFIP
PDCQSLLRGMIEVDAARRLTLEHIQKHIWYIGGKNEPEPEQPIPRKVQIRSLPSLEDIDP
DVLDSMHSLGCFRDRNKLLQDLLSEEENQEKMIYFLLLDRKERYPSQEDEDLPPRNEIDP
PRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIEMAQHGQRSRSISGASSGL
STSPLSSPRVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPSSPSVGGVPWRARLN
SIKNSFLGSPRFHRRKLQVPTPEEMSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKD
KPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGE
AQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSDTTNCMEMMTGRLS
KCGSPLSNFFDVIKQLFSDEKNGQAAQAPSTPAKRSAHGPLGDSAAAGPGPGGDAEYPTG
KDTAKMGPPTARREQP
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgacggggaaggacggcggcgcgcagcacgcgcagtatgttgggccctaccgg
ctggagaagacgctgggcaaggggcagacaggtctggtgaagctgggggttcactgcgtc
acctgccagaaggtggccatcaagatcgtcaaccgtgagaagctcagcgagtcggtgctg
atgaaggtggagcgggagatcgcgatcctgaagctcattgagcacccccacgtcctaaag
ctgcacgacgtttatgaaaacaaaaaatatttgtacctggtgctagaacacgtgtcaggt
ggtgagctcttcgactacctggtgaagaaggggaggctgacgcctaaggaggctcggaag
ttcttccggcagatcatctctgcgctggacttctgccacagccactccatatgccacagg
gatctgaaacctgaaaacctcctgctggacgagaagaacaacatccgcatcgcagacttt
ggcatggcgtccctgcaggttggcgacagcctgttggagaccagctgtgggtccccccac
tacgcctgccccgaggtgatccggggggagaagtatgacggccggaaggcggacgtgtgg
agctgcggcgtcatcctgttcgccttgctggtgggggctctgcccttcgacgatgacaac
ttgcgacagctgctggagaaggtgaagcggggcgtgttccacatgccgcactttatcccg
cccgactgccagagtctgctacggggcatgatcgaggtggacgccgcacgccgcctcacg
ctagagcacattcagaaacacatatggtatatagggggcaagaatgagcccgaaccagag
cagcccattcctcgcaaggtgcagatccgctcgctgcccagcctggaggacatcgacccc
gacgtgctggacagcatgcactcactgggctgcttccgagaccgcaacaagctgctgcag
gacctgctgtccgaggaggagaaccaggagaagatgatttacttcctcctcctggaccgg
aaagaaaggtacccgagccaggaggatgaggacctgcccccccggaacgagatagaccct
ccccggaagcgtgtggactccccgatgctgaaccggcacggcaagcggcggccagaacgc
aaatccatggaggtgctcagcgtgacggacggcggctccccggtgcctgcgcggcgggcc
attgagatggcccagcacggccagaggtctcggtccatcagcggtgcctcctcaggcctt
tccaccagcccactcagcagcccccgggtgacccctcacccctcaccaaggggcagtccc
ctccccacccccaaggggacacctgtccacacgccaaaggagagcccggctggcacgccc
aaccccacgcccccgtccagccccagcgtcggaggggtgccctggagggcgcggctcaac
tccatcaagaacagctttctgggctcaccccgcttccaccgccggaaactgcaagttccg
acgccggaggagatgtccaacctgacaccagagtcgtccccagagctggcgaagaagtcc
tggtttgggaacttcatcagcctggagaaggaggagcagatcttcgtggtcatcaaagac
aaacctctgagctccatcaaggctgacatcgtgcacgccttcctgtcgattcccagtctc
agccacagcgtcatctcccaaacgagcttccgggccgagtacaaggccacgggggggcca
gccgtgttccagaagccggtcaagttccaggttgatatcacctacacggagggtggggag
gcgcagaaggagaacggcatctactccgtcaccttcaccctgctctcaggccccagccgt
cgcttcaagagggtggtggagaccatccaggcccagctgctgagcacacacgacccgcct
gcggcccagcacttgtcagacaccactaactgtatggaaatgatgacggggcggctttcc
aaatgtggcagcccattgagtaacttctttgacgtaattaaacaacttttttcagacgag
aagaacgggcaggcggcccaggcccccagcacgcccgccaagcggagtgcccacggccca
ctcggtgactccgcggccgctggccctggccccggaggggacgccgagtacccaacgggc
aaggacacggccaagatgggcccgcccaccgcccgccgcgagcagccttag

DBGET integrated database retrieval system