KEGG   Homo sapiens (human): 90249Help
Entry
90249             CDS       T01001                                 

Gene name
UNC5A, UNC5H1
Definition
(RefSeq) unc-5 netrin receptor A
  KO
K07521  netrin receptor unc-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    90249 (UNC5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPA ZU5 Death Ig_3 I-set Ig_2 ig TSP_1
Motif
Other DBs
NCBI-GeneID: 90249
NCBI-ProteinID: NP_588610
OMIM: 607869
HGNC: 12567
Ensembl: ENSG00000113763
Vega: OTTHUMG00000163225
Pharos: Q6ZN44(Tbio)
UniProt: Q6ZN44
Structure
PDB: 

Jmol
Position
5q35.2
AA seq 842 aa AA seqDB search
MAVRPGLWPALLGIVLAAWLRGSGAQQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKP
VLLVCKAVPATQIFFKCNGEWVRQVDHVIERSTDGSSGLPTMEVRINVSRQQVEKVFGLE
EYWCQCVAWSSSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAE
VEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVY
VDGSWSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECQGTDLDTRNCTSDLCVHTASGP
EDVALYVGLIAVAVCLVLLLLVLILVYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADN
PHLLTIQPDLSTTTTTYQGSLCPRQDGPSPKFQLTNGHLLSPLGGGRHTLHHSSPTSEAE
EFVSRLSTQNYFRSLPRGTSNMTYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYL
TLHKPEDVRLPLAGCQTLLSPIVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLKKQSC
EGSWEDVLHLGEEAPSHLYYCQLEASACYVFTEQLGRFALVGEALSVAAAKRLKLLLFAP
VACTSLEYNIRVYCLHDTHDALKEVVQLEKQLGGQLIQEPRVLHFKDSYHNLRLSIHDVP
SSLWKSKLLVSYQEIPFYHIWNGTQRYLHCTFTLERVSPSTSDLACKLWVWQVEGDGQSF
SINFNITKDTRFAELLALESEAGVPALVGPSAFKIPFLIRQKIISSLDPPCRRGADWRTL
AQKLHLDSHLSFFASKPSPTAMILNLWEARHFPNGNLSQLAAAVAGLGQPDAGLFTVSEA
EC
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggccgtccggcccggcctgtggccagcgctcctgggcatagtcctcgccgcttggctc
cgcggctcgggtgcccagcagagtgccaccgtggccaacccagtgcctggtgccaacccg
gacctgcttccccacttcctggtggagcccgaggatgtgtacatcgtcaagaacaagcca
gtgctgcttgtgtgcaaggccgtgcccgccacgcagatcttcttcaagtgcaacggggag
tgggtgcgccaggtggaccacgtgatcgagcgcagcacagacgggagcagtgggctgccc
accatggaggtccgcattaatgtctcaaggcagcaggtcgagaaggtgttcgggctggag
gaatactggtgccagtgcgtggcatggagctcctcgggcaccaccaagagtcagaaggcc
tacatccgcatagcctatttgcgcaagaacttcgagcaggagccgctggccaaggaggtg
tccctggagcagggcatcgtgctgccctgccgtccaccggagggcatccctccagccgag
gtggagtggctccggaacgaggacctggtggacccgtccctggaccccaatgtatacatc
acgcgggagcacagcctggtggtgcgacaggcccgccttgctgacacggccaactacacc
tgcgtggccaagaacatcgtggcacgtcgccgcagcgcctccgctgctgtcatcgtctac
gtggacggcagctggagcccgtggagcaagtggtcggcctgtgggctggactgcacccac
tggcggagccgtgagtgctctgacccagcaccccgcaacggaggggaggagtgccagggc
actgacctggacacccgcaactgtaccagtgacctctgtgtacacactgcttctggccct
gaggacgtggccctctatgtgggcctcatcgccgtggccgtctgcctggtcctgctgctg
cttgtcctcatcctcgtttattgccggaagaaggaggggctggactcagatgtggctgac
tcgtccattctcacctcaggcttccagcccgtcagcatcaagcccagcaaagcagacaac
ccccatctgctcaccatccagccggacctcagcaccaccaccaccacctaccagggcagt
ctctgtccccggcaggatgggcccagccccaagttccagctcaccaatgggcacctgctc
agccccctgggtggcggccgccacacactgcaccacagctctcccacctctgaggccgag
gagttcgtctcccgcctctccacccagaactacttccgctccctgccccgaggcaccagc
aacatgacctatgggaccttcaacttcctcgggggccggctgatgatccctaatacagga
atcagcctcctcatccccccagatgccataccccgagggaagatctatgagatctacctc
acgctgcacaagccggaagacgtgaggttgcccctagctggctgtcagaccctgctgagt
cccatcgttagctgtggaccccctggcgtcctgctcacccggccagtcatcctggctatg
gaccactgtggggagcccagccctgacagctggagcctgcgcctcaaaaagcagtcgtgc
gagggcagctgggaggatgtgctgcacctgggcgaggaggcgccctcccacctctactac
tgccagctggaggccagtgcctgctacgtcttcaccgagcagctgggccgctttgccctg
gtgggagaggccctcagcgtggctgccgccaagcgcctcaagctgcttctgtttgcgccg
gtggcctgcacctccctcgagtacaacatccgggtctactgcctgcatgacacccacgat
gcactcaaggaggtggtgcagctggagaagcagctggggggacagctgatccaggagcca
cgggtcctgcacttcaaggacagttaccacaacctgcgcctatccatccacgatgtgccc
agctccctgtggaagagtaagctccttgtcagctaccaggagatccccttttatcacatc
tggaatggcacgcagcggtacttgcactgcaccttcaccctggagcgtgtcagccccagc
actagtgacctggcctgcaagctgtgggtgtggcaggtggagggcgacgggcagagcttc
agcatcaacttcaacatcaccaaggacacaaggtttgctgagctgctggctctggagagt
gaagcgggggtcccagccctggtgggccccagtgccttcaagatccccttcctcattcgg
cagaagataatttccagcctggacccaccctgtaggcggggtgccgactggcggactctg
gcccagaaactccacctggacagccatctcagcttctttgcctccaagcccagccccaca
gccatgatcctcaacctgtgggaggcgcggcacttccccaacggcaacctcagccagctg
gctgcagcagtggctggactgggccagccagacgctggcctcttcacagtgtcggaggct
gagtgctga

DBGET integrated database retrieval system