KEGG   Homo sapiens (human): 90249Help
Entry
90249             CDS       T01001                                 

Gene name
UNC5A, UNC5H1
Definition
unc-5 homolog A (C. elegans)
Orthology
K07521  
netrin receptor unc-5
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Class
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.2
AA seq 842 aa AA seqDB search
MAVRPGLWPALLGIVLAAWLRGSGAQQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKP
VLLVCKAVPATQIFFKCNGEWVRQVDHVIERSTDGSSGLPTMEVRINVSRQQVEKVFGLE
EYWCQCVAWSSSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAE
VEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVY
VDGSWSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECQGTDLDTRNCTSDLCVHTASGP
EDVALYVGLIAVAVCLVLLLLVLILVYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADN
PHLLTIQPDLSTTTTTYQGSLCPRQDGPSPKFQLTNGHLLSPLGGGRHTLHHSSPTSEAE
EFVSRLSTQNYFRSLPRGTSNMTYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYL
TLHKPEDVRLPLAGCQTLLSPIVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLKKQSC
EGSWEDVLHLGEEAPSHLYYCQLEASACYVFTEQLGRFALVGEALSVAAAKRLKLLLFAP
VACTSLEYNIRVYCLHDTHDALKEVVQLEKQLGGQLIQEPRVLHFKDSYHNLRLSIHDVP
SSLWKSKLLVSYQEIPFYHIWNGTQRYLHCTFTLERVSPSTSDLACKLWVWQVEGDGQSF
SINFNITKDTRFAELLALESEAGVPALVGPSAFKIPFLIRQKIISSLDPPCRRGADWRTL
AQKLHLDSHLSFFASKPSPTAMILNLWEARHFPNGNLSQLAAAVAGLGQPDAGLFTVSEA
EC
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggccgtccggcccggcctgtggccagcgctcctgggcatagtcctcgccgcttggctc
cgcggctcgggtgcccagcagagtgccaccgtggccaacccagtgcctggtgccaacccg
gacctgcttccccacttcctggtggagcccgaggatgtgtacatcgtcaagaacaagcca
gtgctgcttgtgtgcaaggccgtgcccgccacgcagatcttcttcaagtgcaacggggag
tgggtgcgccaggtggaccacgtgatcgagcgcagcacagacgggagcagtgggctgccc
accatggaggtccgcattaatgtctcaaggcagcaggtcgagaaggtgttcgggctggag
gaatactggtgccagtgcgtggcatggagctcctcgggcaccaccaagagtcagaaggcc
tacatccgcatagcctatttgcgcaagaacttcgagcaggagccgctggccaaggaggtg
tccctggagcagggcatcgtgctgccctgccgtccaccggagggcatccctccagccgag
gtggagtggctccggaacgaggacctggtggacccgtccctggaccccaatgtatacatc
acgcgggagcacagcctggtggtgcgacaggcccgccttgctgacacggccaactacacc
tgcgtggccaagaacatcgtggcacgtcgccgcagcgcctccgctgctgtcatcgtctac
gtggacggcagctggagcccgtggagcaagtggtcggcctgtgggctggactgcacccac
tggcggagccgtgagtgctctgacccagcaccccgcaacggaggggaggagtgccagggc
actgacctggacacccgcaactgtaccagtgacctctgtgtacacactgcttctggccct
gaggacgtggccctctatgtgggcctcatcgccgtggccgtctgcctggtcctgctgctg
cttgtcctcatcctcgtttattgccggaagaaggaggggctggactcagatgtggctgac
tcgtccattctcacctcaggcttccagcccgtcagcatcaagcccagcaaagcagacaac
ccccatctgctcaccatccagccggacctcagcaccaccaccaccacctaccagggcagt
ctctgtccccggcaggatgggcccagccccaagttccagctcaccaatgggcacctgctc
agccccctgggtggcggccgccacacactgcaccacagctctcccacctctgaggccgag
gagttcgtctcccgcctctccacccagaactacttccgctccctgccccgaggcaccagc
aacatgacctatgggaccttcaacttcctcgggggccggctgatgatccctaatacagga
atcagcctcctcatccccccagatgccataccccgagggaagatctatgagatctacctc
acgctgcacaagccggaagacgtgaggttgcccctagctggctgtcagaccctgctgagt
cccatcgttagctgtggaccccctggcgtcctgctcacccggccagtcatcctggctatg
gaccactgtggggagcccagccctgacagctggagcctgcgcctcaaaaagcagtcgtgc
gagggcagctgggaggatgtgctgcacctgggcgaggaggcgccctcccacctctactac
tgccagctggaggccagtgcctgctacgtcttcaccgagcagctgggccgctttgccctg
gtgggagaggccctcagcgtggctgccgccaagcgcctcaagctgcttctgtttgcgccg
gtggcctgcacctccctcgagtacaacatccgggtctactgcctgcatgacacccacgat
gcactcaaggaggtggtgcagctggagaagcagctggggggacagctgatccaggagcca
cgggtcctgcacttcaaggacagttaccacaacctgcgcctatccatccacgatgtgccc
agctccctgtggaagagtaagctccttgtcagctaccaggagatccccttttatcacatc
tggaatggcacgcagcggtacttgcactgcaccttcaccctggagcgtgtcagccccagc
actagtgacctggcctgcaagctgtgggtgtggcaggtggagggcgacgggcagagcttc
agcatcaacttcaacatcaccaaggacacaaggtttgctgagctgctggctctggagagt
gaagcgggggtcccagccctggtgggccccagtgccttcaagatccccttcctcattcgg
cagaagataatttccagcctggacccaccctgtaggcggggtgccgactggcggactctg
gcccagaaactccacctggacagccatctcagcttctttgcctccaagcccagccccaca
gccatgatcctcaacctgtgggaggcgcggcacttccccaacggcaacctcagccagctg
gctgcagcagtggctggactgggccagccagacgctggcctcttcacagtgtcggaggct
gagtgctga

DBGET integrated database retrieval system