KEGG   Homo sapiens (human): 9025Help
Entry
9025              CDS       T01001                                 

Gene name
RNF8, hRNF8
Definition
(RefSeq) ring finger protein 8
  KO
K10667  E3 ubiquitin-protein ligase RNF8 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     9025 (RNF8)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    9025 (RNF8)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Ubiquitin ligases
     9025 (RNF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FHA zf-C3HC4_3 zf-C3HC4 zf-C3HC4_2 zf-RING_2 zf-C3HC4_4 zf-RING_5 zf-RING_UBOX Prok-RING_4 zf-rbx1 Yop-YscD_cpl zf-ANAPC11 zf-RING_6 zf-RING_10 Peptidase_S76
Motif
Other DBs
NCBI-GeneID: 9025
NCBI-ProteinID: NP_003949
OMIM: 611685
HGNC: 10071
Ensembl: ENSG00000112130
Vega: OTTHUMG00000014620
Pharos: O76064(Tbio)
UniProt: O76064
Structure
PDB: 

Jmol
Position
6p21.2
AA seq 485 aa AA seqDB search
MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMIS
RNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEY
EYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVS
CESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSS
ASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLC
AEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKD
FEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAH
SFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERK
AKRLF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgggggagcccggcttcttcgtcacaggagaccgcgccggtggccggagctggtgcctg
cggcgggtggggatgagcgccgggtggctgctgctggaagatgggtgcgaggtgactgta
ggacgaggatttggtgtcacataccaactggtatcaaaaatctgccccctgatgatttct
cgaaaccactgtgttttgaagcagaatcctgagggccaatggacaattatggacaacaag
agtctaaatggtgtttggctgaacagagcgcgtctggaacctttaagggtctattccatt
catcagggagactacatccaacttggagtgcctctggaaaataaggagaatgcggagtat
gaatatgaagttactgaagaagactgggagacaatatatccttgtctttccccaaagaat
gaccaaatgatagaaaaaaataaggaattgagaactaaaaggaaattcagtttggatgaa
ttagcaggtcctggagctgaaggcccctcaaatttgaaatccaaaataaataaagtgtct
tgtgaatctggtcagccagtgaaatcacaggggaaaggtgaagtggccagtacaccctct
gacaatttggatcctaagttgactgcccttgagccaagtaagaccacaggggctcccatt
taccctggcttccccaaagtcacagaggttcatcatgagcagaaagcctcaaactcttca
gcatctcagagaagcttacagatgtttaaggtgaccatgtccaggattctgaggctcaaa
atacagatgcaggaaaaacatgaagccgttatgaatgtgaaaaagcagacccaaaagggg
aactcaaagaaagttgtgcaaatggagcaggaacttcaggacttacagtcccagctgtgt
gcagagcaggctcagcagcaggcaagagtggagcaactagagaagactttccaggaagag
gaacagcatcttcagggtttggagatagcccaaggagaaaaggacctgaagcaacagctg
gcccaggctctgcaggagcattgggctctaatggaagagctaaatcgcagcaagaaggac
tttgaagcaatcattcaagccaagaacaaagaattagagcagaccaaggaagagaaggag
aagatgcaagcacagaaggaagaagttcttagccacatgaatgatgtgctagagaatgag
ctccaatgtattatttgttcagaatacttcattgaggctgtcaccttgaactgtgcccac
agtttctgctcctactgtatcaatgaatggatgaagcggaagatagaatgccccatttgt
cggaaggacattaagtccaaaacgtactctttggttctggacaattgcattaataagatg
gtaaataatctgagctcagaagtgaaagaacgacgaattgttctcattagggaacgaaaa
gcaaagagattgttctga

DBGET integrated database retrieval system