KEGG   Homo sapiens (human): 9025Help
Entry
9025              CDS       T01001                                 

Gene name
RNF8, hRNF8
Definition
(RefSeq) ring finger protein 8 (EC:6.3.2.-)
  KO
K10667  
E3 ubiquitin-protein ligase RNF8 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     9025 (RNF8)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    9025 (RNF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 485 aa AA seqDB search
MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMIS
RNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEY
EYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVS
CESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSS
ASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLC
AEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKD
FEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAH
SFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERK
AKRLF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgggggagcccggcttcttcgtcacaggagaccgcgccggtggccggagctggtgcctg
cggcgggtggggatgagcgccgggtggctgctgctggaagatgggtgcgaggtgactgta
ggacgaggatttggtgtcacataccaactggtatcaaaaatctgccccctgatgatttct
cgaaaccactgtgttttgaagcagaatcctgagggccaatggacaattatggacaacaag
agtctaaatggtgtttggctgaacagagcgcgtctggaacctttaagggtctattccatt
catcagggagactacatccaacttggagtgcctctggaaaataaggagaatgcggagtat
gaatatgaagttactgaagaagactgggagacaatatatccttgtctttccccaaagaat
gaccaaatgatagaaaaaaataaggaattgagaactaaaaggaaattcagtttggatgaa
ttagcaggtcctggagctgaaggcccctcaaatttgaaatccaaaataaataaagtgtct
tgtgaatctggtcagccagtgaaatcacaggggaaaggtgaagtggccagtacaccctct
gacaatttggatcctaagttgactgcccttgagccaagtaagaccacaggggctcccatt
taccctggcttccccaaagtcacagaggttcatcatgagcagaaagcctcaaactcttca
gcatctcagagaagcttacagatgtttaaggtgaccatgtccaggattctgaggctcaaa
atacagatgcaggaaaaacatgaagccgttatgaatgtgaaaaagcagacccaaaagggg
aactcaaagaaagttgtgcaaatggagcaggaacttcaggacttacagtcccagctgtgt
gcagagcaggctcagcagcaggcaagagtggagcaactagagaagactttccaggaagag
gaacagcatcttcagggtttggagatagcccaaggagaaaaggacctgaagcaacagctg
gcccaggctctgcaggagcattgggctctaatggaagagctaaatcgcagcaagaaggac
tttgaagcaatcattcaagccaagaacaaagaattagagcagaccaaggaagagaaggag
aagatgcaagcacagaaggaagaagttcttagccacatgaatgatgtgctagagaatgag
ctccaatgtattatttgttcagaatacttcattgaggctgtcaccttgaactgtgcccac
agtttctgctcctactgtatcaatgaatggatgaagcggaagatagaatgccccatttgt
cggaaggacattaagtccaaaacgtactctttggttctggacaattgcattaataagatg
gtaaataatctgagctcagaagtgaaagaacgacgaattgttctcattagggaacgaaaa
gcaaagagattgttctga

DBGET integrated database retrieval system