KEGG   Homo sapiens (human): 90293Help
Entry
90293             CDS       T01001                                 

Gene name
KLHL13, BKLHD2, KIAA1309
Definition
(RefSeq) kelch like family member 13
  KO
K10447  
kelch-like protein 9/13
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    90293 (KLHL13)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Target recognizing subunit (BTB)
     90293 (KLHL13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq23-q24
AA seq 655 aa AA seqDB search
MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGGSEMGLSSHLQS
SKAGPTRIFTSNTHSSVVLQGFDQLRLEGLLCDVTLMPGDTDDAFPVHRVMMASASDYFK
AMFTGGMKEQDLMCIKLHGVSKVGLRKIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVL
DFCKVFLISGVTLDNCVEVGRIANTYNLTEVDKYVNSFVLKNFPALLSTGEFLKLPFERL
AFVLSSNSLKHCTELELFKATCRWLRLEEPRMDFAAKLMKNIRFPLMTPQELINYVQTVD
FMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDTTHLVTLGGVLRQQLVVSKELR
MYDEKAHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNK
WMQVASLNEKRTFFHLSALKGYLYAVGGRNAAGELPTVECYNPRTNEWTYVAKMSEPHYG
HAGTVYGGVMYISGGITHDTFQKELMCFDPDTDKWIQKAPMTTVRGLHCMCTVGERLYVI
GGNHFRGTSDYDDVLSCEYYSPILDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNR
CMVEIVQKYDPDKDEWHKVFDLPESLGGIRACTLTVFPPEETTPSPSRESPLSAP
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgccattgaaatggaaaacgagctctcctgctatctggaaattcccagttcctgtgctt
aaaacatccaggtcaactccactttctccagcatacatatctctcgtggaagaggaagac
caacacatgaaattgtcccttggaggcagcgaaatgggcctctcatcccatttgcagtct
tccaaggcaggacctacacgcatctttaccagcaatacccacagttctgtggtgttacag
ggctttgaccagcttcgacttgaaggattgctttgtgatgtgaccctgatgccaggtgac
acagatgatgctttccctgtgcatagagtcatgatggcatctgctagtgattacttcaag
gctatgttcacaggtggaatgaaagaacaagatttaatgtgcattaaacttcatggtgtg
agcaaagtcggtctaaggaaaattattgatttcatttatactgcaaagctttctcttaat
atggacaaccttcaagacacgctggaagctgccagtttcctacagattctgccagttttg
gacttctgtaaagtgtttctcatatctggggtcactttagacaactgtgttgaagttgga
cggattgccaacacctacaatctaaccgaagtggataaatacgttaacagtttcgtcttg
aagaattttcctgcattgctgagcacaggggagttcttgaaactcccttttgagcgtctt
gccttcgtgctttccagtaatagccttaagcactgtactgaacttgagctctttaaggct
acctgtcgttggcttcgcctggaagagcctcggatggactttgctgcaaaattaatgaag
aacatacgatttccactgatgacaccacaggagctcattaattacgtgcaaacggtggat
ttcatgagaactgacaatacttgtgtgaatttgcttttggaagccagcaattaccaaatg
atgccatatatgcagccagttatgcagtcagacaggactgccattaggtctgacaccact
cacttggttacactaggaggagtgctgaggcagcagctggttgtcagtaaggaattgcgc
atgtatgatgaaaaggcccatgagtggaaatcgttagcccccatggatgccccaaggtac
cagcatggcatcgccgtcattggaaattttctctatgtggttggcggacagagtaattat
gatacaaaaggaaaaacggcagttgatacagtcttcagatttgatcctcgatacaataaa
tggatgcaagttgcatctttaaatgaaaagcgcaccttcttccacctaagtgccctcaaa
ggatatctgtatgcagttggtgggcgaaatgcagcaggtgaactgcccacagtagaatgt
tacaatccaagaacaaatgaatggacctatgttgccaaaatgagtgagccccactatggc
catgctggaactgtgtatggaggagtgatgtatatttcaggaggaattactcatgatact
ttccaaaaggagctcatgtgctttgaccctgatactgacaaatggatccagaaggcgcca
atgaccactgtcagaggtctgcattgcatgtgtacagtgggagaaaggctctatgtcatt
ggtggcaatcacttcagaggaacaagtgattatgatgatgtcctaagctgtgaatactat
tcacctatccttgaccagtggaccccaattgctgccatgttaagagggcagagtgatgtt
ggggtcgctgtcttcgaaaataaaatctatgtggttggggggtattcttggaataatcgt
tgtatggtagagatagtgcagaaatatgatccagataaagatgaatggcataaggttttt
gatctgccagaatcccttggtggcattcgtgcttgcacactcacagtttttccaccagaa
gaaaccacaccatcaccttctagagagtcccctctttctgcaccttaa

DBGET integrated database retrieval system