KEGG   Homo sapiens (human): 9034Help
Entry
9034              CDS       T01001                                 

Gene name
CCRL2, ACKR5, CKRX, CRAM, CRAM-A, CRAM-B, HCR
Definition
(RefSeq) C-C motif chemokine receptor like 2
  KO
K08373  
C-C chemokine receptor-like 2
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CC Chemokine
    9034 (CCRL2)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   9034 (CCRL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21
AA seq 344 aa AA seqDB search
MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVV
LILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFF
NCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYK
CAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLV
FAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLY
AFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggccaattacacgctggcaccagaggatgaatatgatgtcctcatagaaggtgaactg
gagagcgatgaggcagagcaatgtgacaagtatgacgcccaggcactctcagcccagctg
gtgccatcactctgctctgctgtgtttgtgatcggtgtcctggacaatctcctggttgtg
cttatcctggtaaaatataaaggactcaaacgcgtggaaaatatctatcttctaaacttg
gcagtttctaacttgtgtttcttgcttaccctgcccttctgggctcatgctgggggcgat
cccatgtgtaaaattctcattggactgtacttcgtgggcctgtacagtgagacatttttc
aattgccttctgactgtgcaaaggtacctagtgtttttgcacaagggaaactttttctca
gccaggaggagggtgccctgtggcatcattacaagtgtcctggcatgggtaacagccatt
ctggccactttgcctgaattcgtggtttataaacctcagatggaagaccagaaatacaag
tgtgcatttagcagaactcccttcctgccagctgatgagacattctggaagcattttctg
actttaaaaatgaacatttcggttcttgtcctccccctatttatttttacatttctctat
gtgcaaatgagaaaaacactaaggttcagggagcagaggtatagccttttcaagcttgtt
tttgccataatggtagtcttccttctgatgtgggcgccctacaatattgcatttttcctg
tccactttcaaagaacacttctccctgagtgactgcaagagcagctacaatctggacaaa
agtgttcacatcactaaactcatcgccaccacccactgctgcatcaaccctctcctgtat
gcgtttcttgatgggacatttagcaaatacctctgccgctgtttccatctgcgtagtaac
accccacttcaacccagggggcagtctgcacaaggcacatcgagggaagaacctgaccat
tccaccgaagtgtaa

DBGET integrated database retrieval system