KEGG   Homo sapiens (human): 9034Help
Entry
9034              CDS       T01001                                 

Gene name
CCRL2, ACKR5, CKRX, CRAM, CRAM-A, CRAM-B, HCR
Definition
(RefSeq) C-C motif chemokine receptor like 2
  KO
K08373  C-C chemokine receptor-like 2
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CC Chemokine
    9034 (CCRL2)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   9034 (CCRL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 DUF389
Motif
Other DBs
NCBI-GeneID: 9034
NCBI-ProteinID: NP_003956
OMIM: 608379
HGNC: 1612
Ensembl: ENSG00000121797
Vega: OTTHUMG00000156318
Pharos: O00421(Tbio)
UniProt: O00421 B2R8C0
Position
3p21.31
AA seq 344 aa AA seqDB search
MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVV
LILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFF
NCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYK
CAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLV
FAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLY
AFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggccaattacacgctggcaccagaggatgaatatgatgtcctcatagaaggtgaactg
gagagcgatgaggcagagcaatgtgacaagtatgacgcccaggcactctcagcccagctg
gtgccatcactctgctctgctgtgtttgtgatcggtgtcctggacaatctcctggttgtg
cttatcctggtaaaatataaaggactcaaacgcgtggaaaatatctatcttctaaacttg
gcagtttctaacttgtgtttcttgcttaccctgcccttctgggctcatgctgggggcgat
cccatgtgtaaaattctcattggactgtacttcgtgggcctgtacagtgagacatttttc
aattgccttctgactgtgcaaaggtacctagtgtttttgcacaagggaaactttttctca
gccaggaggagggtgccctgtggcatcattacaagtgtcctggcatgggtaacagccatt
ctggccactttgcctgaattcgtggtttataaacctcagatggaagaccagaaatacaag
tgtgcatttagcagaactcccttcctgccagctgatgagacattctggaagcattttctg
actttaaaaatgaacatttcggttcttgtcctccccctatttatttttacatttctctat
gtgcaaatgagaaaaacactaaggttcagggagcagaggtatagccttttcaagcttgtt
tttgccataatggtagtcttccttctgatgtgggcgccctacaatattgcatttttcctg
tccactttcaaagaacacttctccctgagtgactgcaagagcagctacaatctggacaaa
agtgttcacatcactaaactcatcgccaccacccactgctgcatcaaccctctcctgtat
gcgtttcttgatgggacatttagcaaatacctctgccgctgtttccatctgcgtagtaac
accccacttcaacccagggggcagtctgcacaaggcacatcgagggaagaacctgaccat
tccaccgaagtgtaa

DBGET integrated database retrieval system