KEGG   Homo sapiens (human): 9037Help
Entry
9037              CDS       T01001                                 

Gene name
SEMA5A, SEMAF, semF
Definition
(RefSeq) semaphorin 5A
  KO
K06841  
semaphorin 5
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Disease
H00764  
Chromosme 5p deletion syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    9037 (SEMA5A)
Cell adhesion molecules and their ligands [BR:hsa04516]
 4. Link Protein Family
  AGC1, CSPG1; aggrecan 1 [KO:K06792]
   9037 (SEMA5A)
  VCAN, CSPG2; versican core protein [KO:K06793]
   9037 (SEMA5A)
  NCAN, CSPG3; neurocan core protein [KO:K06794]
   9037 (SEMA5A)
  CSPG4; chondroitin sulfate proteoglycan 4 [KO:K08115]
   9037 (SEMA5A)
  BCAN; brevican [KO:K06795]
   9037 (SEMA5A)
  PTPRZ; receptor-type tyrosine-protein phosphatase zeta [KO:K08114]
   9037 (SEMA5A)
 7. Others
  PLXNB; plexin B [KO:K06821]
   9037 (SEMA5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13591(Tbio)
UniProt: 
Position
5p15.31
AA seq 1074 aa AA seqDB search
MKGTCVIAWLFSSLGLWRLAHPEAQGTTQCQRTEHPVISYKEIGPWLREFRAKNAVDFSQ
LTFDPGQKELVVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYIRV
LLVGGDRLFTCGTNAFTPVCTNRSLSNLTEIHDQISGMARCPYSPQHNSTALLTAGGELY
AATAMDFPGRDPAIYRSLGILPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEH
DCGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQSTFFLPEL
DLIYGIFTTNVNSIAASAVCVFNLSAIAQAFSGPFKYQENSRSAWLPYPNPNPHFQCGTV
DQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGREALVHII
YLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLREHVV
KIPLKRCQFYRTRSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSISACPTRNLTVD
GHFGVWSPWTPCTHTDGSAVGSCLCRTRSCDSPAPQCGGWQCEGPGMEIANCSRNGGWTP
WTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHMFWTGWG
PWERCTAQCGGGIQARRRICENGPDCAGCNVEYQSCNTNPCPELKKTTPWTPWTPVNISD
NGGHYEQRFRYTCKARLADPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSA
HTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPV
DGVWSCWSPWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWS
EWSDWSECEASGVQVRARQCILLFPMGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEE
KRCGEFNMFHMIAVGLSSSILGCLLTLLVYTYCQRYQQQSHDATVIHPVSPAPLNTSITN
HINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTDLNNYDEY
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaacctgtgttatagcatggctgttctcaagcctggggctgtggagactcgcc
cacccagaggcccagggtacgactcagtgccagagaaccgagcatccagtcatctcctat
aaagaaattggcccctggttacgggagttcagagcgaagaatgctgtggatttctcgcag
ttaacatttgacccaggacagaaagaacttgttgtaggagcaagaaactacctcttcagg
ttacagcttgaggatctgtctcttatccaggctgtggaatgggagtgtgatgaagctacc
aaaaaggcctgttacagcaaaggcaaatcaaaggaggaatgtcagaactacatccgggtg
cttctggtgggtggcgaccggttattcacctgtgggaccaatgcattcacgcctgtctgc
accaaccgctcgttgagcaacctgactgagatccatgatcagatcagtggcatggcccgc
tgtccctacagtccccagcacaattccacagcgctcctcacagctggtggggagctctat
gctgctacagccatggattttccaggacgtgatcctgccatttaccgaagcctaggcatt
ttacctcctctccgcacggcgcagtacaactccaaatggctcaatgagccaaactttgtg
tcatcttatgacatcggaaattttacctacttctttttccgagaaaatgcagtagagcat
gactgtgggaaaacagtgttctccagagctgcccgggtgtgcaagaacgatattggtggg
cgcttcctgctggaagacacctggaccacattcatgaaggctcgcctgaactgctcccgt
cctggggaagtccccttttactacaacgaattgcagagtactttcttcctgcctgagctg
gatttgatctatggcatctttaccaccaatgtgaacagcattgcggcctcagctgtgtgc
gtcttcaacctgagcgccatcgcgcaggccttctctgggcccttcaagtaccaagaaaac
tcgcgctcggcctggctaccgtatcccaacccaaacccccacttccagtgtggcaccgtg
gaccagggcctgtacgtgaacctgaccgagagaaatctgcaggatgctcagaagttcatt
ctgatgcatgaggtggtacagccagtgaccacagtgccctccttcatggaggacaatagc
cgcttttcccacgtggcagtcgacgtggtgcagggcagagaagcgctcgtccacatcatc
tatttggccacagattacggaaccattaagaaagtgcgggtacccctgaatcagacctca
agcagctgtttgctggaagagattgagctcttccctgagaggcggagggagcccatcagg
agcctgcagatcctgcacagccagagtgtcctgttcgtgggcctgcgggagcacgtggtc
aagatccccctgaagaggtgccagttctaccgcacacgcagcacctgcattggggcccag
gacccttactgtggctgggatgtggtaatgaagaaatgcacaagcctggaggagagcctg
agcatgacgcagtgggaacagagcatctctgcgtgtccgaccaggaatctcaccgtggat
gggcactttggtgtgtggtctccgtggacgccttgcacgcacacagatggcagcgccgtg
ggatcctgcctctgtcgaacccgctcctgcgacagcccggccccgcagtgtggtggctgg
cagtgcgagggccctggcatggagatcgccaactgttccaggaacggaggctggactccc
tggacctcgtggtctccctgcagcactacctgtgggatcggcttccaggtgcggcagcgc
tcctgcagcaaccccactcccaggcacgggggccgggtgtgcgtgggacagaaccgcgag
gaaagatactgcaatgaacatttgctatgtcccccacacatgttctggacaggctggggt
ccttgggaacggtgcacagcccaatgcgggggtggcattcaagctcgccgcaggatctgt
gagaatgggcctgactgtgcaggctgcaatgtggagtaccagtcttgcaacaccaacccg
tgtcctgagctgaagaagaccacgccctggacaccctggacacctgtcaacatctctgac
aacggcggccactatgagcaacgattccgatacacatgcaaagcccgcctggctgatccg
aatttgctggaagtgggaagacagagaatcgaaatgcggtactgttctagcgacggcacc
agtggctgctccacagatgggctttctggggatttcctgcgtgctgggagatactctgcc
cacacggtcaacggggcttggtcagcctggacgtcgtggtcacagtgcagccgtgactgc
agcaggggcattcggaaccggaagcgtgtttgcaacaaccccgaacccaagtatggggga
atgccttgccttggcccatctctggaataccaggaatgcaacattttgccctgcccagtg
gatggcgtgtggtcttgctggtccccctggacaaaatgttcagcaacatgcggcggtgga
cactatatgaggacccgctcttgctccaatccagccccggcctatggaggggacatctgc
ctggggctgcacacagaagaggcactctgcaacacgcagccctgcccagagagctggtcg
gagtggtcggactggtctgagtgtgaagcctctggcgtccaagtccgcgcccgccagtgc
atcctcctgttccccatgggcagccagtgctccgggaacaccacggagagccggccgtgt
gtgtttgactctaatttcatcccagaagtatctgtggcaagatccagtagcgtagaagag
aaaaggtgtggagagttcaacatgttccacatgatcgccgtggggctgagcagctccatc
ctcggctgcctcctcaccctgctcgtctatacttactgccagcggtaccagcagcaatcc
cacgatgcgactgtcatccaccccgtctcacctgccccccttaataccagcataaccaac
cacatcaacaaactggacaagtacgactcggtggaggccatcaaggcatttaacaaaaac
aacttgatcctagaggaaagaaacaaatacttcaacccacatctcactgggaagacctat
tctaatgcctactttacagatctcaataattatgatgagtactaa

DBGET integrated database retrieval system