KEGG   Homo sapiens (human): 9038Help
Entry
9038              CDS       T01001                                 

Gene name
TAAR5, PNR
Definition
trace amine associated receptor 5
Orthology
K05051  
trace amine associated receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9038 (TAAR5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Trace amine
    9038 (TAAR5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q23
AA seq 337 aa AA seqDB search
MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNVFVAFAVS
YFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLT
SIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLS
QWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSL
AGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSAC
NPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagagctgtcttcatccaaggtgctgaagagcaccctgcggcattctgctaccaggtg
aatgggtcttgccccaggacagtacatactctgggcatccagttggtcatctacctggcc
tgtgcagcaggcatgctgattatcgtgctagggaatgtatttgtggcatttgctgtgtcc
tacttcaaagcgcttcacacgcccaccaacttcctgctgctctccctggccctggctgac
atgtttctgggtctgctggtgctgcccctcagcaccattcgctcagtggagagctgctgg
ttcttcggggacttcctctgccgcctgcacacctacctggacaccctcttctgcctcacc
tccatcttccatctctgtttcatttccattgaccgccactgtgccatctgtgaccccctg
ctctatccctccaagttcacagtgagggtggctctcaggtacatcctggcaggatggggg
gtgcccgcagcatacacttcgttattcctctacacagatgtggtagagacaaggctcagc
cagtggctggaagagatgccttgtgtgggcagttgccagctgctgctcaataaattttgg
ggctggttaaacttccctttgttctttgtcccctgcctcattatgatcagcttgtatgtg
aagatctttgtggttgctaccagacaggctcagcagattaccacattgagcaaaagcctg
gctggggctgccaagcatgagagaaaagctgccaagaccctgggcattgctgtgggcata
tacctcttgtgctggctgcccttcaccatagacacgatggtcgacagcctccttcacttt
atcacacccccactggtctttgacatctttatctggtttgcttacttcaactcagcctgc
aaccccatcatctatgtcttttcctaccagtggtttcggaaggcactgaaactcacactg
agccagaaggtcttctcaccgcagacacgcactgttgatttgtaccaagaatga

DBGET integrated database retrieval system