KEGG   Homo sapiens (human): 90423Help
Entry
90423             CDS       T01001                                 

Gene name
ATP6V1E2, ATP6E1, ATP6EL2, ATP6V1EL2, VMA4
Definition
ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2
Orthology
K02150  
V-type H+-transporting ATPase subunit E
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    90423 (ATP6V1E2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    90423 (ATP6V1E2)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    90423 (ATP6V1E2)
  Nervous system
   04721 Synaptic vesicle cycle
    90423 (ATP6V1E2)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    90423 (ATP6V1E2)
  Infectious diseases
   05110 Vibrio cholerae infection
    90423 (ATP6V1E2)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    90423 (ATP6V1E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p21
AA seq 226 aa AA seqDB search
MALSDVDVKKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKK
EKQIEQQKKILMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV
LQGLLRLLEPVMIVRCRPQDLLLVEAAVQKAIPEYMTISQKHVEVQIDKEAYLAVNAAGG
VEVYSGNQRIKVSNTLESRLDLSAKQKMPEIRMALFGANTNRKFFI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggccctgagtgatgtcgatgtgaaaaagcagattaagcacatgatggctttcattgag
caggaagccaatgagaaagcagaggaaatcgatgccaaggctgaggaagagtttaacatt
gagaaaggacgcctcgtgcaaacccaacgactgaagattatggagtattatgagaaaaag
gagaagcagatagagcagcagaagaaaatcctgatgtccaccatgaggaatcaggcgagg
ctgaaagtcctgagagcccgaaatgacctcatctcagatttgctcagtgaggcgaagctg
agactcagcaggattgtggaggacccagaggtctaccaggggctgctggataaactggtg
ctccagggtctgctccgactgctggaacctgtgatgattgtacgctgccggccacaagac
ctcctcctggtggaggctgctgtacaaaaagccatccccgagtacatgacaatttcccag
aaacatgtggaggtccagattgataaagaggcatacctggctgtgaatgcagctggaggt
gtggaggtctacagtggcaatcagagaataaaggtttcaaataccttggaaagccgactg
gatctctcagccaagcaaaagatgccagaaatacgaatggccttgtttggtgctaacacc
aacagaaagttctttatataa

DBGET integrated database retrieval system