KEGG   Homo sapiens (human): 9047Help
Entry
9047              CDS       T01001                                 

Gene name
SH2D2A, F2771, SCAP, TSAD, VRAP
Definition
(RefSeq) SH2 domain containing 2A
  KO
K08273  SH2 domain protein 2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04370  VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    9047 (SH2D2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2
Motif
Other DBs
NCBI-GeneID: 9047
NCBI-ProteinID: NP_001154916
OMIM: 604514
HGNC: 10821
Ensembl: ENSG00000027869
Vega: OTTHUMG00000041305
Pharos: Q9NP31(Tbio)
UniProt: Q9NP31
Position
1q23.1
AA seq 389 aa AA seqDB search
MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASNTGNAERAE
EVPGEGSLFLQAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLEPKPQGCYLVR
FSESAVTFVLTYRSRTCCRHFLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSPYGE
TLTEPLARQTPEPAGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAPVPMQKEGAGEKEPS
QLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIYNEPDEPIAFYAMGRGSPGEA
PSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQGPPLPHQPPP
AWRHTLPHNLSRQVLQDRGQAWLPLGPPQ
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggagttccccctggcccagatatgtccccaagggagtcacgaagcccccatcccaacc
ttcagcaccttccagatcacagacatgacccgcaggagctgccagaacctgggctacact
gcggcatctccccaggccccggaggctgcctccaacacagggaatgctgagagggcagag
gaggtgcctggagaaggaagcctgttcctgcaggccgagacccgggcttggttccagaag
acccaggcccactggctcctgcagcacggggcagcccctgcctggttccatggcttcatc
acccggagggaggcagagaggctgctggagcccaagcctcaggggtgctacttggtgcgg
ttcagcgagagcgcggtgaccttcgtgctgacttacaggagccggacttgctgccgccac
ttcctgctggcccagctcagggacgggcgccacgtggtgctgggcgaggacagcgcccac
gcgcggctgcaggacctgctgctgcactacaccgcgcacccgctcagcccctacggggag
acgctcaccgagcccctcgcccgacagactcctgagcctgcaggactttccctgaggacc
gaagaatcaaactttggaagcaaaagccaggacccaaacccccagtacagcccaatcatc
aaacaggggcaagccccagtcccgatgcagaaagagggggccggggagaaggagccctcc
cagctgctcaggcccaagcctcccatccccgccaaacctcagctgcccccagaagtctac
acaatccctgttccacgacaccgcccggccccacgccccaagccctccaatcctatctac
aatgagcctgatgaacccatagctttctatgccatgggccggggcagccctggggaagcc
cccagcaacatctatgtggaagtggaagatgagggcctacccgccacccttgggcaccct
gtcctacggaagagctggtccaggcctgtcccaggaggccagaatacaggtggctcccag
ctgcattctgagaactctgtgattgggcaaggccctcccctgccccaccagcccccaccc
gcctggagacacaccctcccccacaatctttctagacaggtgcttcaggacagaggacag
gcatggcttccccttgggcctcctcagtag

DBGET integrated database retrieval system