KEGG   Homo sapiens (human): 9047Help
Entry
9047              CDS       T01001                                 

Gene name
SH2D2A, F2771, SCAP, TSAD, VRAP
Definition
SH2 domain containing 2A
Orthology
K08273  
SH2 domain protein 2A
Organism
hsa  Homo sapiens (human)
Pathway
VEGF signaling pathway
Class
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:hsa04370]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21
AA seq 399 aa AA seqDB search
MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASNTGNAERAE
EVPGEGSLFLQAETRAWFQKTQAHWLLQHGAAPAWFHGFITRRVRPPLSVTHREAERLLE
PKPQGCYLVRFSESAVTFVLTYRSRTCCRHFLLAQLRDGRHVVLGEDSAHARLQDLLLHY
TAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAPVPMQ
KEGAGEKEPSQLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIYNEPDEPIAFY
AMGRGSPGEAPSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQ
GPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggagttccccctggcccagatatgtccccaagggagtcacgaagcccccatcccaacc
ttcagcaccttccagatcacagacatgacccgcaggagctgccagaacctgggctacact
gcggcatctccccaggccccggaggctgcctccaacacagggaatgctgagagggcagag
gaggtgcctggagaaggaagcctgttcctgcaggccgagacccgggcttggttccagaag
acccaggcccactggctcctgcagcacggggcagcccctgcctggttccatggcttcatc
acccggagggttcggccccctctctccgtcacccacagggaggcagagaggctgctggag
cccaagcctcaggggtgctacttggtgcggttcagcgagagcgcggtgaccttcgtgctg
acttacaggagccggacttgctgccgccacttcctgctggcccagctcagggacgggcgc
cacgtggtgctgggcgaggacagcgcccacgcgcggctgcaggacctgctgctgcactac
accgcgcacccgctcagcccctacggggagacgctcaccgagcccctcgcccgacagact
cctgagcctgcaggactttccctgaggaccgaagaatcaaactttggaagcaaaagccag
gacccaaacccccagtacagcccaatcatcaaacaggggcaagccccagtcccgatgcag
aaagagggggccggggagaaggagccctcccagctgctcaggcccaagcctcccatcccc
gccaaacctcagctgcccccagaagtctacacaatccctgttccacgacaccgcccggcc
ccacgccccaagccctccaatcctatctacaatgagcctgatgaacccatagctttctat
gccatgggccggggcagccctggggaagcccccagcaacatctatgtggaagtggaagat
gagggcctacccgccacccttgggcaccctgtcctacggaagagctggtccaggcctgtc
ccaggaggccagaatacaggtggctcccagctgcattctgagaactctgtgattgggcaa
ggccctcccctgccccaccagcccccacccgcctggagacacaccctcccccacaatctt
tctagacaggtgcttcaggacagaggacaggcatggcttccccttgggcctcctcagtag

DBGET integrated database retrieval system