KEGG   Homo sapiens (human): 9052Help
Entry
9052              CDS       T01001                                 

Gene name
GPRC5A, GPCR5A, PEIG-1, RAI3, RAIG1, TIG1
Definition
(RefSeq) G protein-coupled receptor class C group 5 member A
  KO
K08468  G protein-coupled receptor family C group 5 member A
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Other
   Orphan GPRC5
    9052 (GPRC5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_3
Motif
Other DBs
NCBI-GeneID: 9052
NCBI-ProteinID: NP_003970
OMIM: 604138
HGNC: 9836
Ensembl: ENSG00000013588
Vega: OTTHUMG00000168710
Pharos: Q8NFJ5(Tbio)
UniProt: Q8NFJ5
Position
12p13.1
AA seq 357 aa AA seqDB search
MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSN
RRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLT
KLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLL
LTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRW
DDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAY
SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggctacaacagtccctgatggttgccgcaatggcctgaaatccaagtactacagactt
tgtgataaggctgaagcttggggcatcgtcctagaaacggtggccacagccggggttgtg
acctcggtggccttcatgctcactctcccgatcctcgtctgcaaggtgcaggactccaac
aggcgaaaaatgctgcctactcagtttctcttcctcctgggtgtgttgggcatctttggc
ctcaccttcgccttcatcatcggactggacgggagcacagggcccacacgcttcttcctc
tttgggatcctcttttccatctgcttctcctgcctgctggctcatgctgtcagtctgacc
aagctcgtccgggggaggaagcccctttccctgttggtgattctgggtctggccgtgggc
ttcagcctagtccaggatgttatcgctattgaatatattgtcctgaccatgaataggacc
aacgtcaatgtcttttctgagctttccgctcctcgtcgcaatgaagactttgtcctcctg
ctcacctacgtcctcttcttgatggcgctgaccttcctcatgtcctccttcaccttctgt
ggttccttcacgggctggaagagacatggggcccacatctacctcacgatgctcctctcc
attgccatctgggtggcctggatcaccctgctcatgcttcctgactttgaccgcaggtgg
gatgacaccatcctcagctccgccttggctgccaatggctgggtgttcctgttggcttat
gttagtcccgagttttggctgctcacaaagcaacgaaaccccatggattatcctgttgag
gatgctttctgtaaacctcaactcgtgaagaagagctatggtgtggagaacagagcctac
tctcaagaggaaatcactcaaggttttgaagagacaggggacacgctctatgccccctat
tccacacattttcagctgcagaaccagcctccccaaaaggaattctccatcccacgggcc
cacgcttggccgagcccttacaaagactatgaagtaaagaaagagggcagctaa

DBGET integrated database retrieval system