KEGG   Homo sapiens (human): 9052Help
Entry
9052              CDS       T01001                                 

Gene name
GPRC5A, GPCR5A, PEIG-1, RAI3, RAIG1, TIG1
Definition
(RefSeq) G protein-coupled receptor class C group 5 member A
  KO
K08468  
G protein-coupled receptor family C group 5 member A
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Other
   Orphan GPRC5
    9052 (GPRC5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13.1
AA seq 357 aa AA seqDB search
MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSN
RRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLT
KLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLL
LTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRW
DDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAY
SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggctacaacagtccctgatggttgccgcaatggcctgaaatccaagtactacagactt
tgtgataaggctgaagcttggggcatcgtcctagaaacggtggccacagccggggttgtg
acctcggtggccttcatgctcactctcccgatcctcgtctgcaaggtgcaggactccaac
aggcgaaaaatgctgcctactcagtttctcttcctcctgggtgtgttgggcatctttggc
ctcaccttcgccttcatcatcggactggacgggagcacagggcccacacgcttcttcctc
tttgggatcctcttttccatctgcttctcctgcctgctggctcatgctgtcagtctgacc
aagctcgtccgggggaggaagcccctttccctgttggtgattctgggtctggccgtgggc
ttcagcctagtccaggatgttatcgctattgaatatattgtcctgaccatgaataggacc
aacgtcaatgtcttttctgagctttccgctcctcgtcgcaatgaagactttgtcctcctg
ctcacctacgtcctcttcttgatggcgctgaccttcctcatgtcctccttcaccttctgt
ggttccttcacgggctggaagagacatggggcccacatctacctcacgatgctcctctcc
attgccatctgggtggcctggatcaccctgctcatgcttcctgactttgaccgcaggtgg
gatgacaccatcctcagctccgccttggctgccaatggctgggtgttcctgttggcttat
gttagtcccgagttttggctgctcacaaagcaacgaaaccccatggattatcctgttgag
gatgctttctgtaaacctcaactcgtgaagaagagctatggtgtggagaacagagcctac
tctcaagaggaaatcactcaaggttttgaagagacaggggacacgctctatgccccctat
tccacacattttcagctgcagaaccagcctccccaaaaggaattctccatcccacgggcc
cacgcttggccgagcccttacaaagactatgaagtaaagaaagagggcagctaa

DBGET integrated database retrieval system