KEGG   Homo sapiens (human): 9053Help
Entry
9053              CDS       T01001                                 

Gene name
MAP7, E-MAP-115, EMAP115
Definition
(RefSeq) microtubule associated protein 7
  KO
K10433  
microtubule-associated protein 7
Organism
hsa  Homo sapiens (human)
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     9053 (MAP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q23.3
AA seq 749 aa AA seqDB search
MAELGAGGDGHRGGDGAVRSETAPDSYKVQDKKNASSRPASAISGQNNNHSGNKPDPPPV
LRVDDRQRLARERREEREKQLAAREIVWLEREERARQHYEKHLEERKKRLEEQRQKEERR
RAAVEEKRRQRLEEDKERHEAVVRRTMERSQKPKQKHNRWSWGGSLHGSPSIHSADPDRR
SVSTMNLSKYVDPVISKRLSSSSATLLNSPDRARRLQLSPWESSVVNRLLTPTHSFLARS
KSTAALSGEAASCSPIIMPYKAAHSRNSMDRPKLFVTPPEGSSRRRIIHGTASYKKERER
ENVLFLTSGTRRAVSPSNPKARQPARSRLWLPSKSLPHLPGTPRPTSSLPPGSVKAAPAQ
VRPPSPGNIRPVKREVKVEPEKKDPEKEPQKVANEPSLKGRAPLVKVEEATVEERTPAEP
EVGPAAPAMAPAPASAPAPASAPAPAPVPTPAMVSAPSSTVNASASVKTSAGTTDPEEAT
RLLAEKRRLAREQREKEERERREQEELERQKREELAQRVAEERTTRREEESRRLEAEQAR
EKEEQLQRQAEERALREREEAERAQRQKEEEARVREEAERVRQEREKHFQREEQERLERK
KRLEEIMKRTRRTEATDKKTSDQRNGDIAKGALTGGTEVSALPCTTNAPGNGKPVGSPHV
VTSHQSKVTVESTPDLEKQPNENGVSVQNENFEEIINLPIGSKPSRLDVTNSESPEIPLN
PILAFDDEGTLGPLPQVDGVQTQQTAEVI
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctaggagctggcggcgacggccacaggggcggcgacggcgcagtgcgaagc
gaaacagcacccgacagctacaaagtgcaagataagaaaaatgcctccagccgccctgcc
tctgcaatttcaggacaaaataacaaccactcaggaaataaaccagaccctccgcctgtg
ttacgtgttgatgaccggcagcggctggcccgggagcgacgtgaggaacgggagaaacag
ctagctgcaagagaaatagtgtggttagaaagagaagagcgagccaggcagcactacgag
aagcacctggaagagcggaagaagaggttggaggagcagaggcagaaggaggagcggagg
agggctgctgtggaggagaagcggaggcagagacttgaggaggacaaagaacgccacgaa
gctgttgtacggcgcacaatggaaaggagccagaagccaaaacagaagcataaccgttgg
tcgtggggaggctctctccatgggagccctagcatccacagtgcagatccagacaggcgg
tcagtttccaccatgaatctttcgaaatatgttgatcccgtcattagcaagcggctctcc
tcttcatctgcaactttactaaattctccagatagagctcgccgcctgcagctcagccca
tgggagagcagcgttgttaacagactcctgacgcccacacattcgttcctggccagaagt
aaaagcacagctgccttgtctggagaagcagcatcttgcagccccatcatcatgccctac
aaagctgcacactctagaaattcgatggatcgaccaaaactctttgtaacaccacctgag
ggctcttctcgcaggaggatcattcatggcacagcgagctataaaaaagaaagagagaga
gaaaatgtactcttcctcacatctggcacccgaagggctgtatctccatctaatcccaaa
gcaagacaaccagctcgctcccgactttggcttccgtccaagtctcttcctcatttgcct
ggcacacccagaccgacatcctccttgccacccggctcagtcaaagctgctcctgctcag
gtccggcccccatcccccggcaacatccgccctgtcaagagggaagtcaaagtggagcct
gagaagaaagatcctgagaaggaacctcagaaagttgccaatgagccctcactaaagggc
agagcacctttagtgaaggtagaagaagccacagttgaagagcggacacctgctgaacca
gaagttggccctgctgctccagccatggccccagctccagcctcggccccagctccagcc
tcggccccagctccagccccggtccccaccccagccatggtctcagccccgtcatccact
gtgaatgccagtgcttctgttaagacttctgcaggcaccaccgacccagaggaggccaca
aggcttctagctgagaagaggcggctggcccgagagcagagagaaaaggaagaaagggag
aggagggagcaggaagagcttgaaagacaaaagagagaggaattggctcaacgtgtggct
gaagagaggacgactcgccgtgaggaggagtcgcgcaggctggaagccgagcaggcccgg
gagaaggaggagcagctgcagcggcaggcggaggagcgggcgctgcgcgagcgggaggag
gcagagcgcgcccagaggcagaaagaagaagaagctcgcgttcgtgaagaagcagagagg
gtccggcaggaacgagagaagcatttccagagagaagagcaagagcgcctggagagaaag
aagcgacttgaggagattatgaaaagaaccaggagaacagaagctacagataagaaaacc
agtgatcagagaaacggtgatatagccaagggagctctcactggaggaacagaggtgtct
gcacttccatgtacaacaaacgctccgggaaatggaaagccagttggcagcccacatgtg
gttacctcacaccagtcaaaagtgacagtggagagcactcccgatttggaaaaacaacca
aatgaaaatggtgtatctgttcagaatgaaaattttgaagaaattataaacttacccatt
ggatctaaaccatccagattagatgtcaccaacagtgagagcccagaaattcctttgaat
ccaattttggcctttgatgatgaagggacacttgggcccctgcctcaggtagatggtgtt
cagacacagcagactgcagaagttatatga

DBGET integrated database retrieval system