KEGG   Homo sapiens (human): 9054Help
Entry
9054              CDS       T01001                                 

Gene name
NFS1, IscS, NIFS
Definition
NFS1 cysteine desulfurase (EC:2.8.1.7)
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    9054 (NFS1)
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    9054 (NFS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     9054 (NFS1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    9054 (NFS1)
 Prokaryotic Type
    9054 (NFS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q11.22
AA seq 406 aa AA seqDB search
MLLRAAWRRAAVAVTAAPGPKPAAPTRGLRLRVGDRAPQSAVPADTAAAPEVGPVLRPLY
MDVQATTPLDPRVLDAMLPYLINYYGNPHSRTHAYGWESEAAMERARQQVASLIGADPRE
IIFTSGATESNNIAIKELEAAIQPDTSLVSVMTVNNEIGVKQPIAEIGRICSSRKVYFHT
DAAQAVGKIPLDVNDMKIDLMSISGHKIYGPKGVGAIYIRRRPRVRVEALQSGGGQERGM
RSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYP
GCINLSFAYVEGESLLMALKDVALSSGSACTSASLEPSYVLRAIGTDEDLAHSSIRFGIG
RFTTEEEVDYTVEKCIQHVKRLREMSPLWEMVQDGIDLKSIKWTQH
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgctgctccgagccgcttggaggcgggcggcagtggcggtgacagcggctccagggccg
aagcccgcggcgcccactcgggggctgcgcctgcgcgttggagaccgtgctcctcagtct
gcggttcccgcagatacagccgctgccccggaggtggggccagtgctgcgacctctctat
atggatgtgcaagctacaactcctctggacccccgggtgcttgatgccatgctcccttac
ctaatcaactactatgggaacccacactcccggacacatgcttatggctgggagagtgag
gcagccatggaacgtgctcgtcagcaagtagcatctctgattggagctgatcctcgtgag
atcatttttactagtggtgctactgaatccaacaacatagcaattaaggaactagaggct
gctatccagccagatactagcctggtgtcagtcatgactgtgaacaatgagattggagtg
aagcagcctattgcagaaatagggcggatttgcagttccagaaaggtatatttccatact
gatgcagcccaggctgttggaaaaatcccacttgatgtcaatgacatgaaaattgatctc
atgagcattagtggtcacaaaatctacggtcccaaaggggttggtgccatctacatccgt
cgccggccccgtgtgcgtgtggaggccctgcagagtggaggggggcaggagcggggtatg
cggtctgggacagtgcccacacccttagtggtggggctgggggctgcgtgtgaggtggca
cagcaagagatggagtatgaccacaagcgaatctcaaagttgtcagagcggctgatacag
aatataatgaagagccttccagatgtggtgatgaatggggaccctaagcaccattatccc
ggctgtatcaacctctcctttgcatatgtggaaggggaaagtctgctgatggcactgaag
gacgttgccttatcctcagggagtgcctgcacctctgcatccctggagccctcttatgtg
cttagagcaattggcactgatgaggatttagcgcactcttctatcaggtttggaattggc
cgcttcactacagaggaggaagtggactacacagtggagaaatgcattcagcatgtgaag
cgtcttcgagaaatgagccctctctgggagatggttcaggatggcattgacctcaagagc
atcaagtggacccaacactag

DBGET integrated database retrieval system