KEGG   Homo sapiens (human): 9056Help
Entry
9056              CDS       T01001                                 

Gene name
SLC7A7, LAT3, LPI, MOP-2, Y+LAT1, y+LAT-1
Definition
(RefSeq) solute carrier family 7 member 7
  KO
K13867  
solute carrier family 7 (L-type amino acid transporter), member 7
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Disease
H00899  
Lysinuric protein intolerance (LPI)
H01400  
Secondary hyperammonemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    9056 (SLC7A7)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   9056 (SLC7A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9UM01(Tbio)
UniProt: 
Position
14q11.2
AA seq 511 aa AA seqDB search
MVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPK
GVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRL
WTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWG
TLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYS
GWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTF
ADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVP
SLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFF
PIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRPLYLRRIVGSAT
RYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggttgacagcactgagtatgaagtggcctcccagcctgaggtggaaacctcccctttg
ggtgatggggccagcccagggccggagcaggtgaagctgaagaaggagatctcactgctt
aacggcgtgtgcctgattgtggggaacatgatcggctcgggcatctttgtttcccccaag
ggtgtgctcatatacagtgcctcctttggtctctctctggtcatctgggctgtcgggggc
ctcttctccgtctttggggccctttgttatgcggaactgggcaccaccattaagaaatct
ggggccagctatgcctatatcctggaggcctttggaggattccttgctttcatcagactc
tggacctccctgctcatcattgagcccaccagccaggccatcattgccatcacctttgcc
aactacatggtacagcctctcttcccgagctgcttcgccccttatgctgccagccgcctg
ctggctgctgcctgcatttgtctcttaaccttcattaactgtgcctatgtcaaatgggga
accctggtacaagatattttcacctatgctaaagtattggcactgatcgcggtcatcgtt
gcaggcattgttagacttggccagggagcctctactcattttgagaattcctttgagggt
tcatcatttgcagtgggtgacattgccctggcactgtactcagctctgttctcctactca
ggctgggacaccctcaactatgtcactgaagagatcaagaatcctgagaggaacctgccc
ctctccattggcatctccatgcccattgtcaccatcatctatatcttgaccaatgtggcc
tattatactgtgctagacatgagagacatcttggccagtgatgctgttgctgtgactttt
gcagatcagatatttggaatatttaactggataattccactgtcagttgcattatcctgt
tttggtggcctcaatgcctccattgtggctgcttctaggcttttctttgtgggctcaaga
gaaggccatctccctgatgccatctgcatgatccatgttgagcggttcacaccagtgcct
tctctgctcttcaatggtatcatggcattgatctacttgtgcgtggaagacatcttccag
ctcattaactactacagcttcagctactggttctttgtggggctttctattgtgggtcag
ctttatctgcgctggaaggagcctgatcgacctcgtcccctcaagctcagcgttttcttc
ccgattgtcttctgcctctgcaccatcttcctggtggctgttccactttacagtgatact
atcaactccctcatcggcattgccattgccctctcaggcctgcccttttacttcctcatc
atcagagtgccagaacataagcgaccgctttacctccgaaggatcgtggggtctgccaca
aggtacctccaggtcctgtgtatgtcagttgctgcagaaatggatttggaagatggagga
gagatgcccaagcaacgggatcccaaatctaactaa

DBGET integrated database retrieval system