KEGG   Homo sapiens (human): 9057Help
Entry
9057              CDS       T01001                                 

Gene name
SLC7A6, LAT-2, LAT3, y+LAT-2
Definition
(RefSeq) solute carrier family 7 member 6
  KO
K13872  
solute carrier family 7 (L-type amino acid transporter), member 6
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   9057 (SLC7A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22.1
AA seq 515 aa AA seqDB search
MEAREPGRPTPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKEISLLNGVSLVVGNMIG
SGIFVSPKGVLVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFG
GFIAFIRLWVSLLVVEPTGQAIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTFV
NCAYVKWGTRVQDTFTYAKVVALIAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLAL
YSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNISDVLS
SDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPDLLSMIH
IERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRWKEPKRPR
PLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFI
RNVLAAITRGTQQLCFCVLTELDVAEEKKDERKTD
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggaagccagggagcctgggaggcccacacccacctaccatcttgtccctaacaccagc
cagtcccaggtggaagaagatgtcagctcgccacctcaaaggtcctccgaaactatgcag
ctgaagaaggagatctccctgctgaatggggtcagcctggtggtgggcaacatgatcggc
tcagggatctttgtctcacccaagggtgtgctggtacacactgcctcctatgggatgtca
ctgattgtgtgggccattggtgggctcttctctgttgtgggtgccctttgttatgcagag
ctggggaccaccatcaccaagtcgggagccagctacgcttatattctagaggcctttggg
ggcttcattgccttcatccgcctgtgggtctcactgctagttgttgagcccaccggtcag
gccatcatcgccatcacctttgccaactacatcatccagccgtccttccccagctgtgat
cccccatacctggcctgccgtctcctggctgctgcttgcatatgtctgctgacatttgtg
aactgtgcctatgtcaagtggggcacacgtgtgcaggacacgttcacttacgccaaggtc
gtagcgctcattgccatcattgtcatgggccttgttaaactgtgccagggacactctgag
cactttcaggacgcctttgagggttcctcctgggacatgggaaacctctctcttgccctc
tactctgccctcttctcttactcaggttgggacacccttaattttgtaacagaagaaatc
aaaaacccagaaagaaatttgcccttggccattgggatttctatgccaattgtgacgctc
atctacatcctgaccaatgtggcctattacacagtgctgaacatttcagatgtccttagc
agtgatgctgtggctgtgacatttgctgaccagacgtttggcatgttcagctggaccatc
cccattgctgttgccctgtcctgctttgggggcctcaatgcatccatctttgcttcatca
aggttgttcttcgtgggctcccgggagggccacctaccggaccttctgtccatgatccac
attgagcgttttacacctatccctgctttactgttcaattgcaccatggcactcatctac
ctcatcgtggaggatgttttccagcttatcaactacttcagcttcagctactggttcttc
gtgggcctgtctgttgttggacagctctacctccgctggaaggagcccaagcggccccgg
cctctcaagctgagcgtgtttttccccatcgtgttctgcatatgctccgtgtttctggtg
atagtgcccctcttcactgacaccattaattccctcattggcatcgggattgccctttct
ggagtccctttctacttcatgggtgtttacctgccagagtcccggaggccattgtttatt
cggaatgtcctggctgctatcaccagaggcacccagcagctttgcttttgtgtcctgact
gagcttgatgtagccgaagaaaaaaaggatgagaggaaaactgactag

DBGET integrated database retrieval system