KEGG   Homo sapiens (human): 9063Help
Entry
9063              CDS       T01001                                 

Gene name
PIAS2, ARIP3, DIP, MIZ, MIZ1, PIASX, PIASX-ALPHA, PIASX-BETA, SIZ2, ZMIZ4
Definition
protein inhibitor of activated STAT, 2
Orthology
K16063  
E3 SUMO-protein ligase PIAS2 [EC:6.3.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Jak-STAT signaling pathway
Pathways in cancer
Small cell lung cancer
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q21.1
AA seq 621 aa AA seqDB search
MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIREL
YRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGS
VLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFI
FALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFP
LPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLT
SAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAV
TCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQE
DGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDE
EEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTP
ISSMSSDLPGLDFLSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSSHESSTHVSSSSS
RSETGVITSSGSNIPDIISLD
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttcgaagagttgaggaatatggtttctagttttagggtttctgaactacaa
gtattactaggctttgctggacggaataaaagtggacgcaagcatgacctcctgatgagg
gcgctgcatttattgaagagcggctgcagccctgcggttcagattaaaatccgagaattg
tatagacgccgatatccacgaactcttgaaggactttctgatttatccacaatcaaatca
tcggttttcagtttggatggtggctcatcacctgtagaacctgacttggccgtggctgga
atccactcgttgccttccacttcagttacacctcactcaccatcctctcctgttggttct
gtgctgcttcaagatactaagcccacatttgagatgcagcagccatctcccccaattcct
cctgtccatcctgatgtgcagttaaaaaatctgcccttttatgatgtccttgatgttctc
atcaagcccacgagtttagttcaaagcagtattcagcgatttcaagagaagttttttatt
tttgctttgacacctcaacaagttagagagatatgcatatccagggattttttgccaggt
ggtaggagagattatacagtccaagttcagttgagactttgcctggcagagacaagttgc
cctcaagaagataactatccaaatagtctatgtataaaagtaaatgggaagctatttcct
ttgcctggctatgcaccaccgcctaaaaatgggattgaacagaagcgccctggacgcccc
ttgaatattacatctttagttaggttatcttcagctgtgccaaaccaaatttccatttct
tgggcatcagaaattgggaagaattactctatgtctgtatatcttgtacggcagcttaca
tcagccatgttattacagagattaaaaatgaaaggtattagaaaccctgatcattccaga
gcactaattaaagaaaaacttactgcagatcctgatagtgaaattgctacaactagcctt
cgggtatccttgatgtgccctttaggaaaaatgaggctgacaatcccatgccgtgcagtg
acttgtacacatctgcagtgttttgatgctgccctctatctacaaatgaatgagaaaaag
cccacctggatttgtcctgtgtgtgacaaaaaagctgcctatgaaagtctaatattagat
gggctttttatggaaattctcaatgactgttctgatgtagatgagatcaaattccaagaa
gatggttcttggtgtccaatgagaccgaagaaagaagctatgaaagtatccagccaaccg
tgtacaaaaatagaaagttcaagcgtcctcagtaagccttgttcagtgactgtagccagt
gaggcaagcaagaagaaagtagatgttattgatcttacaatagaaagctcttctgacgaa
gaggaagaccctcctgccaaaaggaaatgcatctttatgtcagaaacacaaagcagccca
accaaaggggttctcatgtatcagccatcttctgtaagggtgcccagtgtgacttcggtt
gatcctgctgctattccgccttcattaacagactactcagtaccattccaccatacgcca
atatcaagcatgtcatcagatttgccaggtttggattttctttcccttattccagttgat
ccccagtactgtcctcctatgtttttggatagtctcacctcacccttaacagcaagcagt
acgtctgtcaccaccaccagctcccatgaaagcagtactcatgttagttcatccagcagc
aggagtgagacaggggtcataaccagcagtggaagtaacattcctgacatcatctcattg
gactaa

DBGET integrated database retrieval system