KEGG   Homo sapiens (human): 9066Help
Entry
9066              CDS       T01001                                 

Gene name
SYT7, IPCA-7, IPCA7, PCANAP7, SYT-VII, SYTVII
Definition
(RefSeq) synaptotagmin 7
  KO
K19907  
synaptotagmin-7
Organism
hsa  Homo sapiens (human)
Brite
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    9066 (SYT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q12.2
AA seq 403 aa AA seqDB search
MYRDPEAASPGAPSRDVLLVSAIITVSLSVTVVLCGLCHWCQRKLGKRYKNSLETVGTPD
SGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSP
GSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLL
PDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSI
PLNKVDLTQMQTFWKDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGG
TSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDK
LSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgggacccggaggcggccagcccaggggcgccctcgcgcgacgtcctgctggtc
tctgccatcatcaccgtcagccttagcgtcactgtcgtcctctgcggcctctgccactgg
tgtcagcgcaaactgggcaaacgctacaagaattccttggagacggtgggcacgccagac
tcagggcgtgggcgcagtgagaagaaggctatcaagttgcctgcaggagggaaggcggtg
aacacagcccccgtgccaggccagacaccccacgatgagtccgaccgccggaccgagcca
cgttcctccgtctcagacctcgtcaactccctcaccagcgagatgctcatgctctcccca
ggctccgaggaggatgaggcccacgagggttgcagccgagagaacctgggccggatccag
ttcagtgtcggctacaacttccaggagtccacgctcaccgtgaagatcatgaaggcccag
gagctgccggccaaggacttcagcggcaccagcgaccccttcgtcaagatctacctgctg
cccgacaagaagcacaagctggagaccaaggtgaagcggaagaacctgaacccccactgg
aacgagaccttcctctttgaaggttttccctatgagaaggtggtgcagaggatcctctac
ctccaagtcctggactatgaccgcttcagccgcaacgaccccattggggaggtgtccatc
ccccttaacaaggtggacctgacccagatgcagaccttctggaaggatctgaagccatgc
agcgatgggagtgggagccgaggggagctgctcttgtctctctgctacaacccctctgcc
aactccatcatcgtgaacatcatcaaagcccggaacctcaaagccatggacatcgggggc
acatcagacccctacgtgaaggtatggctgatgtacaaggacaagcgggtggagaagaag
aagacggtgacgatgaagaggaacctgaaccccatcttcaatgagtccttcgccttcgat
atccccacggagaagctgagggagacgaccatcatcatcactgtcatggacaaggacaag
ctcagccgcaatgacgtcatcggcaagatctacctgtcctggaagagcgggccaggggag
gtgaagcactggaaggacatgattgcccgtccccggcagcccgtggcccagtggcaccag
ctgaaggcctga

DBGET integrated database retrieval system