KEGG   Homo sapiens (human): 90678Help
Entry
90678             CDS       T01001                                 

Gene name
LRSAM1, CMT2P, RIFLE, TAL
Definition
leucine rich repeat and sterile alpha motif containing 1
Orthology
K10641  
E3 ubiquitin-protein ligase LRSAM1 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     90678 (LRSAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q33.3
AA seq 723 aa AA seqDB search
MPLFFRKRKPSEEARKRLEYQMCLAKEAGADDILDISKCELSEIPFGAFATCKVLQKKVL
IVHTNHLTSLLPKSCSLLSLATIKVLDLHDNQLTALPDDLGQLTALQVLNVERNQLMQLP
RSIGNLTQLQTLNVKDNKLKELPDTVGELRSLRTLNISGNEIQRLPQMLAHVRTLEMLSL
DASAMVYPPREVCGAGTAAILQFLCKESGLEYYPPSQYLLPILEQDGIENSRDSPDGPTD
RFSREELEWQNRFSDYEKRKEQKMLEKLEFERRLELGQREHTQLLQQSSSQKDEILQTVK
EEQSRLEQGLSEHQRHLNAERQRLQEQLKQTEQNISSRIQKLLQDNQRQKKSSEILKSLE
NERIRMEQLMSITQEETESLRRRDVASAMQQMLTESCKNRLIQMAYESQRQNLVQQACSS
MAEMDERFQQILSWQQMDQNKAISQILQESAMQKAAFEALQVKKDLMHRQIRSQIKLIET
ELLQLTQLELKRKSLDTESLQEMISEQRWALSSLLQQLLKEKQQREEELREILTELEAKS
ETRQENYWLIQYQRLLNQKPLSLKLQEEGMERQLVALLEELSAEHYLPIFAHHRLSLDLL
SQMSPGDLAKVGVSEAGLQHEILRRVQELLDAARIQPELKPPMGEVVTPTAPQEPPESVR
PSAPPAELEVQASECVVCLEREAQMIFLNCGHVCCCQQCCQPLRTCPLCRQDIAQRLRIY
HSS
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcttcttccggaagcggaaacccagtgaggaggctcggaaacgcctggagtac
cagatgtgtttggcaaaagaagctggggcagatgacattctcgacatctctaaatgtgag
ctctcagagattccatttggagcttttgcaacatgcaaagttctgcagaagaaggtgctg
atcgtccacacgaatcacctcacttccctgcttcccaaatcctgcagcctcctgagtctg
gcaaccatcaaggttctagatctccacgataatcagctgacagcccttcctgacgatctg
gggcagctgactgccctccaggtcttaaacgtggaaaggaatcaactgatgcagctccca
cgttccattgggaacctgacccagctccagactctcaatgttaaagacaacaagctgaag
gagcttccagacaccgtgggggagcttcgaagcctgcgtaccctcaacatcagtggaaac
gagatccagagattgccgcagatgctggctcacgttcgaaccctggagatgctgagcctt
gacgcctcggccatggtctacccgccgcgggaggtgtgtggtgccggcactgcggccatc
ttgcagttcctctgcaaagagtcagggctggaatactaccccccttctcagtacttgctg
ccaattctggagcaagatggaatcgagaactctcgggacagccctgatgggcccacggac
agattctcaagggaggagttagagtggcagaacaggttctcagactatgagaagaggaag
gaacagaagatgctggagaaactcgagtttgaacggcgcctggaactggggcagcgggag
cacacccagctccttcagcagagcagcagccagaaggatgagatccttcagacggtcaag
gaggagcagtcccggctggagcagggcctgagtgagcaccagcgccacctcaacgcagag
cggcagcggctgcaggagcagctgaagcagacggaacagaacatttccagccggatccag
aagctgctgcaggacaatcagagacaaaagaaaagctccgagattttgaaatcgctggaa
aatgaaagaataagaatggaacagttgatgtccataacccaggaggagactgagagcctg
cggcgacgtgacgttgcctccgccatgcagcagatgctgactgagagctgtaagaaccgg
ctcatccagatggcctacgaatctcagaggcagaacttggtccagcaggcctgttccagc
atggccgaaatggatgaacgattccagcagattctgtcgtggcagcaaatggatcagaac
aaagccatcagccagatcctgcaggagagcgcgatgcagaaggctgcgttcgaggcactc
caggtgaagaaagacctgatgcatcggcagatcaggagccagattaagttaatagaaact
gagttattgcagctgacacagctggagttaaagaggaagtccctggacacagagtcactc
caggagatgatctcggagcagcgctgggccctcagctccctgctccagcagctgctcaaa
gagaagcagcagcgagaggaagagctccgggaaatcctgacggagttagaagccaaaagt
gaaaccaggcaggaaaattactggctgattcagtatcaacggcttttgaaccagaagccc
ttgtccttgaagctgcaagaagaggggatggagcgccagctggtggccctcctggaggag
ctgtcggctgagcactacctgcccatctttgcgcaccaccgcctctcactggacctgctg
agccaaatgagcccaggggacctggccaaggtgggcgtctcagaagctggcctgcagcac
gagatcctccggagagtccaggaactgctggatgcagccaggatccagccagagctgaaa
ccaccaatgggtgaggtcgtcacccctacggccccccaggagcctcctgagtctgtgagg
ccatccgctccccctgcagagctggaggtgcaggcctcagagtgtgtcgtgtgcctggaa
cgggaggcccagatgatcttcctcaactgtggccacgtctgctgctgccagcagtgctgc
cagccactgcgcacctgcccgctgtgccgccaggacatcgcccagcgcctccgcatctac
cacagcagctga

DBGET integrated database retrieval system