KEGG   Homo sapiens (human): 9074Help
Entry
9074              CDS       T01001                                 

Gene name
CLDN6
Definition
(RefSeq) claudin 6
  KO
K06087  
claudin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9074 (CLDN6)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    9074 (CLDN6)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    9074 (CLDN6)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    9074 (CLDN6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   9074 (CLDN6)
  Exosomal proteins of colorectal cancer cells
   9074 (CLDN6)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  CLDN; claudin [KO:K06087]
   9074 (CLDN6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 220 aa AA seqDB search
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLT
SGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGL
LCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgccggaatgcagatcctgggagtcgtcctgacactgctgggctgggtgaat
ggcctggtctcctgtgccctgcccatgtggaaggtgaccgctttcatcggcaacagcatc
gtggtggcccaggtggtgtgggagggcctgtggatgtcctgcgtggtgcagagcaccggc
cagatgcagtgcaaggtgtacgactcactgctggcgctgccacaggacctgcaggctgca
cgtgccctctgtgtcatcgccctccttgtggccctgttcggcttgctggtctaccttgct
ggggccaagtgtaccacctgtgtggaggagaaggattccaaggcccgcctggtgctcacc
tctgggattgtctttgtcatctcaggggtcctgacgctaatccccgtgtgctggacggcg
catgccatcatccgggacttctataaccccctggtggctgaggcccaaaagcgggagctg
ggggcctccctctacttgggctgggcggcctcaggccttttgttgctgggtggggggttg
ctgtgctgcacttgcccctcgggggggtcccagggccccagccattacatggcccgctac
tcaacatctgcccctgccatctctcgggggccctctgagtaccctaccaagaattacgtc
tga

DBGET integrated database retrieval system