KEGG   Homo sapiens (human): 90865Help
Entry
90865             CDS       T01001                                 

Gene name
IL33, C9orf26, DVS27, IL1F11, NF-HEV, NFEHEV
Definition
(RefSeq) interleukin 33
  KO
K12967  
interleukin 33
Organism
hsa  Homo sapiens (human)
Pathway
Necroptosis
Cytosolic DNA-sensing pathway
Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    90865 (IL33)
 Organismal Systems
  Immune system
   04623 Cytosolic DNA-sensing pathway
    90865 (IL33)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    90865 (IL33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O95760(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
9p24.1
AA seq 270 aa AA seqDB search
MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYF
RRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPIT
EYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGK
MLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFI
GVKDNHLALIKVDSSENLCTENILFKLSET
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctaaaatgaagtattcaaccaacaaaatttccacagcaaagtggaagaacaca
gcaagcaaagccttgtgtttcaagctgggaaaatcccaacagaaggccaaagaagtttgc
cccatgtactttatgaagctccgctctggccttatgataaaaaaggaggcctgttacttt
aggagagaaaccaccaaaaggccttcactgaaaacaggtagaaagcacaaaagacatctg
gtactcgctgcctgtcaacagcagtctactgtggagtgctttgcctttggtatatcaggg
gtccagaaatatactagagcacttcatgattcaagtatcacaggaatttcacctattaca
gagtatcttgcttctctaagcacatacaatgatcaatccattacttttgctttggaggat
gaaagttatgagatatatgttgaagacttgaaaaaagatgaaaagaaagataaggtgtta
ctgagttactatgagtctcaacacccctcaaatgaatcaggtgacggtgttgatggtaag
atgttaatggtaaccctgagtcctacaaaagacttctggttgcatgccaacaacaaggaa
cactctgtggagctccataagtgtgaaaaaccactgccagaccaggccttctttgtcctt
cataatatgcactccaactgtgtttcatttgaatgcaagactgatcctggagtgtttata
ggtgtaaaggataatcatcttgctctgattaaagtagactcttctgagaatttgtgtact
gaaaatatcttgtttaagctctctgaaacttag

DBGET integrated database retrieval system