KEGG   Homo sapiens (human): 9087Help
Entry
9087              CDS       T01001                                 

Gene name
TMSB4Y, TB4Y
Definition
thymosin beta 4, Y-linked
Orthology
K05764  
thymosin, beta 4
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    9087 (TMSB4Y)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Yq11.221
AA seq 44 aa AA seqDB search
MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacctggtatggctgagatcgagaaattcgataagtcgaaactgaagaag
acagaaacgcaagagaagaatccattgtcttccaaagaaactatcgaacaggagaggcaa
gcaggcgaatcttaa

DBGET integrated database retrieval system