KEGG   Homo sapiens (human): 9088Help
Entry
9088              CDS       T01001                                 

Gene name
PKMYT1, MYT1, PPP1R126
Definition
protein kinase, membrane associated tyrosine/threonine 1 (EC:2.7.11.1)
Orthology
K06633  
membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    9088 (PKMYT1)
   04114 Oocyte meiosis
    9088 (PKMYT1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    9088 (PKMYT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9088 (PKMYT1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  WEE family
   9088 (PKMYT1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     9088 (PKMYT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 430 aa AA seqDB search
MLERWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRS
KEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTEL
CGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKL
GDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVACNMELPHGG
EGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLRQPRAWGVLW
CMAAEALSRGWALWQALLALLCWLWHGLAHPASWLQPLGPPATPPGSPPCSLLLDSSLSS
NWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSFPSFEPRNLL
SLFEDTLDPT
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgctagaacgctggcaccagctgcagccccggcgggtgtcattccggggcgaggcctca
gagactctgcagagccctgggtatgacccaagccggccagagtccttcttccagcagagc
ttccagaggctcagccgcctgggccatggctcctacggagaggtcttcaaggtgcgctcc
aaggaggacggccggctctatgcggtaaagcgttccatgtcaccattccggggccccaag
gaccgggcccgcaagttggccgaggtgggcagccacgagaaggtggggcagcacccatgc
tgcgtgcggctggagcaggcctgggaggagggcggcatcctgtacctgcagacggagctg
tgcgggcccagcctgcagcaacactgtgaggcctggggtgccagcctgcctgaggcccag
gtctggggctacctgcgggacacgctgcttgccctggcccatctgcacagccagggcctg
gtgcaccttgatgtcaagcctgccaacatcttcctggggccccggggccgctgcaagctg
ggtgacttcggactgctggtggagctgggtacagcaggagctggtgaggtccaggaggga
gacccccgctacatggcccccgagctgctgcagggctcctatgggacagcagcggatgtg
ttcagtctgggcctcaccatcctggaagtggcatgcaacatggagctgccccacggtggg
gagggctggcagcagctgcgccagggctacctgccccctgagttcactgccggtctgtct
tccgagctgcgttctgtccttgtcatgatgctggagccagaccccaagctgcgggccacg
gccgaggccctgctggcactgcctgtgttgaggcagccgcgggcctggggtgtgctgtgg
tgcatggcagcggaggccctgagccgagggtgggccctgtggcaggccctgcttgccctg
ctctgctggctctggcatgggctggctcaccctgccagctggctacagcccctgggcccg
ccagccaccccgcctggctcaccaccctgcagtttgctcctggacagcagcctctccagc
aactgggatgacgacagcctagggccttcactctcccctgaggctgtcctggcccggact
gtggggagcacctccaccccccggagcaggtgcacacccagggatgccctggacctaagt
gacatcaactcagagcctcctcggggctccttcccctcctttgagcctcggaacctcctc
agcctgtttgaggacaccctagacccaacctga

DBGET integrated database retrieval system