KEGG   Homo sapiens (human): 9088Help
Entry
9088              CDS       T01001                                 

Gene name
PKMYT1, MYT1
Definition
protein kinase, membrane associated tyrosine/threonine 1 (EC:2.7.11.1)
Orthology
K06633  
membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:hsa04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 430 aa AA seqDB search
MLERWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRS
KEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTEL
CGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKL
GDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVACNMELPHGG
EGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLRQPRAWGVLW
CMAAEALSRGWALWQALLALLCWLWHGLAHPASWLQPLGPPATPPGSPPCSLLLDSSLSS
NWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSFPSFEPRNLL
SLFEDTLDPT
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgctagaacgctggcaccagctgcagccccggcgggtgtcattccggggcgaggcctca
gagactctgcagagccctgggtatgacccaagccggccagagtccttcttccagcagagc
ttccagaggctcagccgcctgggccatggctcctacggagaggtcttcaaggtgcgctcc
aaggaggacggccggctctatgcggtaaagcgttccatgtcaccattccggggccccaag
gaccgggcccgcaagttggccgaggtgggcagccacgagaaggtggggcagcacccatgc
tgcgtgcggctggagcaggcctgggaggagggcggcatcctgtacctgcagacggagctg
tgcgggcccagcctgcagcaacactgtgaggcctggggtgccagcctgcctgaggcccag
gtctggggctacctgcgggacacgctgcttgccctggcccatctgcacagccagggcctg
gtgcaccttgatgtcaagcctgccaacatcttcctggggccccggggccgctgcaagctg
ggtgacttcggactgctggtggagctgggtacagcaggagctggtgaggtccaggaggga
gacccccgctacatggcccccgagctgctgcagggctcctatgggacagcagcggatgtg
ttcagtctgggcctcaccatcctggaagtggcatgcaacatggagctgccccacggtggg
gagggctggcagcagctgcgccagggctacctgccccctgagttcactgccggtctgtct
tccgagctgcgttctgtccttgtcatgatgctggagccagaccccaagctgcgggccacg
gccgaggccctgctggcactgcctgtgttgaggcagccgcgggcctggggtgtgctgtgg
tgcatggcagcggaggccctgagccgagggtgggccctgtggcaggccctgcttgccctg
ctctgctggctctggcatgggctggctcaccctgccagctggctacagcccctgggcccg
ccagccaccccgcctggctcaccaccctgcagtttgctcctggacagcagcctctccagc
aactgggatgacgacagcctagggccttcactctcccctgaggctgtcctggcccggact
gtggggagcacctccaccccccggagcaggtgcacacccagggatgccctggacctaagt
gacatcaactcagagcctcctcggggctccttcccctcctttgagcctcggaacctcctc
agcctgtttgaggacaccctagacccaacctga

DBGET integrated database retrieval system