KEGG   Homo sapiens (human): 9092Help
Entry
9092              CDS       T01001                                 

Gene name
SART1, Ara1, HOMS1, SART1259, SNRNP110, Snu66
Definition
squamous cell carcinoma antigen recognized by T cells
Orthology
K11984  
U4/U6.U5 tri-snRNP-associated protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U4/U6.U5 tri-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    9092 (SART1)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP specific factors
    9092 (SART1)
 Complex C
   U4/U6.U5 tri-SnRNP specific factors
    9092 (SART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.1
AA seq 800 aa AA seqDB search
MGSSKKHRGEKEAAGTTAAAGTGGATEQPPRHREHKKHKHRSGGSGGSGGERRKRSRERG
GERGSGRRGAEAEARSSTHGRERSQAEPSERRVKREKRDDGYEAAASSKTSSGDASSLSI
EETNKLRAKLGLKPLEVNAIKKEAGTKEEPVTADVINPMALRQREELREKLAAAKEKRLL
NQKLGKIKTLGEDDPWLDDTAAWIERSRQLQKEKDLAEKRAKLLEEMDQEFGVSTLVEEE
FGQRRQDLYSARDLQGLTVEHAIDSFREGETMILTLKDKGVLQEEEDVLVNVNLVDKERA
EKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGERPHSFRLEQGGTADGL
RERELEEIRAKLRLQAQSLSTVGPRLASEYLTPEEMVTFKKTKRRVKKIRKKEKEVVVRA
DDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGG
APPPGSPQVLEEDEAELELQKQLEKGRRLRQLQQLQQLRDSGEKVVEIVKKLESRQRGWE
EDEDPERKGAIVFNATSEFCRTLGEIPTYGLAGNREEQEELMDFERDEERSANGGSESDG
EENIGWSTVNLDEEKQQQDFSASSTTILDEEPIVNRGLAAALLLCQNKGLLETTVQKVAR
VKAPNKSLPSAVYCIEDKMAIDDKYSRREEYRGFTQDFKEKDGYKPDVKIEYVDETGRKL
TPKEAFRQLSHRFHGKGSGKMKTERRMKKLDEEALLKKMSSSDTPLGTVALLQEKQKAQK
TPYIVLSGSGKSMNANTITK
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgtccaagaagcatcgcggagagaaggaggcggccgggacgacggcggcggcc
ggcaccgggggtgccaccgagcagccgccgcggcaccgggaacacaaaaaacacaagcac
cggagtggcggcagtggcggtagcggtggcgaacgacggaagcggagccgggaacgtggg
ggcgagcgcgggagcgggcggcgcggggccgaagctgaggcccggagcagcacgcacggg
cgggagcgcagccaggcagagccctccgagcggcgcgtgaagcgggagaagcgcgatgac
ggctacgaggccgctgccagctccaaaactagctcaggcgatgcctcctcactcagcatc
gaggagactaacaaactccgggcaaagttggggctgaaacccttggaggttaatgccatc
aagaaggaggcgggcaccaaggaggagcccgtgacagctgatgtcatcaaccctatggcc
ttgcgacagcgagaggagctgcgggagaagctggcggctgccaaggagaagcgcctgctg
aaccaaaagctggggaagataaagaccctaggagaggatgacccctggctggacgacact
gcagcctggatcgagaggagccggcagctgcagaaggagaaggacctggcagagaagagg
gccaagttactggaggagatggaccaagagtttggtgtcagcactctggtggaggaggag
ttcgggcagaggcggcaggacctgtacagtgcccgggacctgcagggcctcaccgtggag
catgccattgattccttccgagaaggggagacaatgattcttaccctcaaggacaaaggc
gtgctgcaggaggaggaggacgtgctggtgaacgtgaacctggtggataaggagcgggca
gagaaaaatgtggagctgcggaagaagaagcctgactacctgccctatgccgaggacgag
agcgtggacgacctggcgcagcaaaaacctcgctctatcctgtccaagtatgacgaagag
cttgaaggggagcggccacattccttccgcttggagcagggcggcacggctgatggcctg
cgggagcgggagctggaggagatccgggccaagctgcggctgcaggctcagtccctgagc
acagtggggccccggctggcctccgaatacctcacgcctgaggagatggtgacctttaaa
aagaccaagcggagggtgaagaaaatccgcaagaaggagaaggaggtagtagtgcgggca
gatgacttgctgcctctcggggaccagactcaggatggggactttggttccagactgcgg
ggacggggtcgccgccgagtgtccgaagtggaggaggagaaggagcctgtgcctcagccc
ctgccgtcggacgacacccgagtggagaacatggacatcagtgatgaggaggaaggtgga
gctccaccgccggggtccccgcaggtgctggaggaggacgaggcggagctggagctgcag
aagcagctggagaagggacgccggctgcgacagttacagcagctacagcagctgcgagac
agtggcgagaaggtggtggagattgtgaagaagctggagtctcgccagcggggctgggag
gaggatgaggatcccgagcggaagggggccatcgtgttcaacgccacgtccgagttctgc
cgcaccttgggggagatccccacctacgggctggctggcaatcgcgaggagcaggaggag
ctcatggactttgaacgggatgaggagcgctcagccaacggtggctccgaatctgacggg
gaggagaacatcggctggagcacggtgaacctggacgaggagaagcagcagcaggatttc
tctgcttcctccaccaccatcctggacgaggaaccgatcgtgaatagggggctggcagct
gccctgctcctgtgtcagaacaaagggctgctggagaccacagtgcagaaggtggcccgg
gtgaaggcccccaacaagtcgctgccctcagccgtgtactgcatcgaggataagatggcc
atcgatgacaagtacagccggagggaggaataccgaggcttcacacaggacttcaaggag
aaggacggctacaaacccgacgttaagatcgaatacgtggatgagacgggccggaaactc
acacccaaggaggctttccggcagctgtcgcaccgcttccatggcaagggctcaggcaag
atgaagacagagcggcggatgaagaagctggacgaggaggcgctcctgaagaagatgagc
tccagcgacacgcccctgggcaccgtggccctgctccaggagaagcagaaggctcagaag
accccctacatcgtgctcagcggcagcggcaagagcatgaacgcgaacaccatcaccaag
tga

DBGET integrated database retrieval system