KEGG   Homo sapiens (human): 9093Help
Entry
9093              CDS       T01001                                 

Gene name
DNAJA3, HCA57, TID1, hTID-1
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member A3
  KO
K09504  DnaJ homolog subfamily A member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    9093 (DNAJA3)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   9093 (DNAJA3)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    9093 (DNAJA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ DnaJ_C DnaJ_CXXCXGXG
Motif
Other DBs
NCBI-GeneID: 9093
NCBI-ProteinID: NP_005138
OMIM: 608382
HGNC: 11808
Ensembl: ENSG00000103423
Vega: OTTHUMG00000129470
Pharos: Q96EY1(Tbio)
UniProt: Q96EY1 Q53G26 Q59E88
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 480 aa AA seqDB search
MAARCSTRWLLVVVGTPRLPAISGRGARPPREGVVGAWLSRKLSVPAFASSLTSCGPRAL
LTLRPGVSLTGTKHNPFICTASFHTSAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKY
HPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYWKGGPTV
DPEELFRKIFGEFSSSSFGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTVNIMDTCERCN
GKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGGRGSIIISPCVVCRGAGQAKQ
KKRVMIPVPAGVEDGQTVRMPVGKREIFITFRVQKSPVFRRDGADIHSDLFISIAQALLG
GTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQ
QSLILSYAEDETDVEGTVNGVTLTSSGGSTMDSSAGSKARREAGEDEEGFLSKLKKMFTS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcggtgctccacacgctggttgctggtggttgtggggaccccgcggctgccg
gctatatcgggtagaggggcccggccgcccagggagggcgtggtgggggcatggctgagc
cgcaagctgagcgtccccgcctttgcgtcttccctgacctcttgcggcccccgagcgctg
ctgacattgagacctggtgtcagccttacaggaacaaaacataaccctttcatttgtact
gcctccttccacacgagtgcccctttggccaaagaagattattatcagatattaggagtg
cctcgaaatgccagccagaaagagatcaagaaagcctattatcagcttgccaagaagtat
caccctgacacaaataaggatgatcccaaagccaaggagaagttctcccagctggcagaa
gcctatgaggttttgagtgatgaggtgaagaggaagcagtacgatgcctacggctctgca
ggcttcgatcctggggccagcggctcccagcatagctactggaagggaggccccactgtg
gaccccgaggagctgttcaggaagatctttggcgagttctcatcctcttcatttggagat
ttccagaccgtgtttgatcagcctcaggaatacttcatggagttgacattcaatcaagct
gcaaagggggtcaacaaggagttcaccgtgaacatcatggacacgtgtgagcgctgcaac
ggcaaggggaacgagcccggcaccaaggtgcagcattgccactactgtggcggctccggc
atggaaaccatcaacacaggcccttttgtgatgcgttccacgtgtaggagatgtggtggc
cgcggctccatcatcatatcgccctgtgtggtctgcaggggagcaggacaagccaagcag
aaaaagcgagtgatgatccctgtgcctgcaggagtcgaggatggccagaccgtgaggatg
cctgtgggaaaaagggaaattttcattacgttcagggtgcagaaaagccctgtgttccgg
agggacggcgcagacatccactccgacctctttatttctatagctcaggctcttcttggg
ggtacagccagagcccagggcctgtacgagacgatcaacgtgacgatcccccctgggact
cagacagaccagaagattcggatgggtgggaaaggcatcccccggattaacagctacggc
tacggagaccactacatccacatcaagatacgagttccaaagaggctaacgagccggcag
cagagcctgatcctgagctacgccgaggacgagacagatgtggaggggacggtgaacggc
gtcaccctcaccagctctggtggcagcaccatggatagctccgcaggaagcaaggctagg
cgtgaggctggggaggacgaggagggattcctttccaaacttaagaaaatgtttacctca
tga

DBGET integrated database retrieval system