KEGG   Homo sapiens (human): 9093Help
Entry
9093              CDS       T01001                                 

Gene name
DNAJA3, HCA57, TID1, hTID-1
Definition
DnaJ (Hsp40) homolog, subfamily A, member 3
Orthology
K09504  
DnaJ homolog subfamily A member 3
Organism
hsa  Homo sapiens (human)
Pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    9093 (DNAJA3)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    9093 (DNAJA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 453 aa AA seqDB search
MAARCSTRWLLVVVGTPRLPAISGRGARPPREGVVGAWLSRKLSVPAFASSLTSCGPRAL
LTLRPGVSLTGTKHNPFICTASFHTSAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKY
HPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYWKGGPTV
DPEELFRKIFGEFSSSSFGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTVNIMDTCERCN
GKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGGRGSIIISPCVVCRGAGQAKQ
KKRVMIPVPAGVEDGQTVRMPVGKREIFITFRVQKSPVFRRDGADIHSDLFISIAQALLG
GTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQ
QSLILSYAEDETDVEGTVNGVTLTSSGKRSTGN
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcggtgctccacacgctggttgctggtggttgtggggaccccgcggctgccg
gctatatcgggtagaggggcccggccgcccagggagggcgtggtgggggcatggctgagc
cgcaagctgagcgtccccgcctttgcgtcttccctgacctcttgcggcccccgagcgctg
ctgacattgagacctggtgtcagccttacaggaacaaaacataaccctttcatttgtact
gcctccttccacacgagtgcccctttggccaaagaagattattatcagatattaggagtg
cctcgaaatgccagccagaaagagatcaagaaagcctattatcagcttgccaagaagtat
caccctgacacaaataaggatgatcccaaagccaaggagaagttctcccagctggcagaa
gcctatgaggttttgagtgatgaggtgaagaggaagcagtacgatgcctacggctctgca
ggcttcgatcctggggccagcggctcccagcatagctactggaagggaggccccactgtg
gaccccgaggagctgttcaggaagatctttggcgagttctcatcctcttcatttggagat
ttccagaccgtgtttgatcagcctcaggaatacttcatggagttgacattcaatcaagct
gcaaagggggtcaacaaggagttcaccgtgaacatcatggacacgtgtgagcgctgcaac
ggcaaggggaacgagcccggcaccaaggtgcagcattgccactactgtggcggctccggc
atggaaaccatcaacacaggcccttttgtgatgcgttccacgtgtaggagatgtggtggc
cgcggctccatcatcatatcgccctgtgtggtctgcaggggagcaggacaagccaagcag
aaaaagcgagtgatgatccctgtgcctgcaggagtcgaggatggccagaccgtgaggatg
cctgtgggaaaaagggaaattttcattacgttcagggtgcagaaaagccctgtgttccgg
agggacggcgcagacatccactccgacctctttatttctatagctcaggctcttcttggg
ggtacagccagagcccagggcctgtacgagacgatcaacgtgacgatcccccctgggact
cagacagaccagaagattcggatgggtgggaaaggcatcccccggattaacagctacggc
tacggagaccactacatccacatcaagatacgagttccaaagaggctaacgagccggcag
cagagcctgatcctgagctacgccgaggacgagacagatgtggaggggacggtgaacggc
gtcaccctcaccagctctggaaaaagatccactggaaactag

DBGET integrated database retrieval system