KEGG   Homo sapiens (human): 91Help
Entry
91                CDS       T01001                                 

Gene name
ACVR1B, ACTRIB, ACVRLK4, ALK4, SKR2
Definition
(RefSeq) activin A receptor type 1B
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Module
hsa_M00681  Activin signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    91 (ACVR1B)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    91 (ACVR1B)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    91 (ACVR1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     91 (ACVR1B)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   91 (ACVR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp APH FTA2
Motif
Other DBs
NCBI-GeneID: 91
NCBI-ProteinID: NP_004293
OMIM: 601300
HGNC: 172
Ensembl: ENSG00000135503
Vega: OTTHUMG00000167920
Pharos: P36896(Tchem)
UniProt: P36896
Position
12q13.13
AA seq 505 aa AA seqDB search
MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLD
GMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPS
MWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQ
DLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSRE
ERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVT
IEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRH
DAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSG
GVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQSYEALRVMGKMMRECWYAN
GAARLTALRIKKTLSQLSVQEDVKI
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtcggccggagcctcctccttcttcccccttgttgtcctcctgctcgccggc
agcggcgggtccgggccccggggggtccaggctctgctgtgtgcgtgcaccagctgcctc
caggccaactacacgtgtgagacagatggggcctgcatggtttccattttcaatctggat
gggatggagcaccatgtgcgcacctgcatccccaaagtggagctggtccctgccgggaag
cccttctactgcctgagctcggaggacctgcgcaacacccactgctgctacactgactac
tgcaacaggatcgacttgagggtgcccagtggtcacctcaaggagcctgagcacccgtcc
atgtggggcccggtggagctggtaggcatcatcgccggcccggtgttcctcctgttcctc
atcatcatcattgttttccttgtcattaactatcatcagcgtgtctatcacaaccgccag
agactggacatggaagatccctcatgtgagatgtgtctctccaaagacaagacgctccag
gatcttgtctacgatctctccacctcagggtctggctcagggttacccctctttgtccag
cgcacagtggcccgaaccatcgttttacaagagattattggcaagggtcggtttggggaa
gtatggcggggccgctggaggggtggtgatgtggctgtgaaaatattctcttctcgtgaa
gaacggtcttggttcagggaagcagagatataccagacggtcatgctgcgccatgaaaac
atccttggatttattgctgctgacaataaagataatggcacctggacacagctgtggctt
gtttctgactatcatgagcacgggtccctgtttgattatctgaaccggtacacagtgaca
attgaggggatgattaagctggccttgtctgctgctagtgggctggcacacctgcacatg
gagatcgtgggcacccaagggaagcctggaattgctcatcgagacttaaagtcaaagaac
attctggtgaagaaaaatggcatgtgtgccatagcagacctgggcctggctgtccgtcat
gatgcagtcactgacaccattgacattgccccgaatcagagggtggggaccaaacgatac
atggcccctgaagtacttgatgaaaccattaatatgaaacactttgactcctttaaatgt
gctgatatttatgccctcgggcttgtatattgggagattgctcgaagatgcaattctgga
ggagtccatgaagaatatcagctgccatattacgacttagtgccctctgacccttccatt
gaggaaatgcgaaaggttgtatgtgatcagaagctgcgtcccaacatccccaactggtgg
cagagttatgaggcactgcgggtgatggggaagatgatgcgagagtgttggtatgccaac
ggcgcagcccgcctgacggccctgcgcatcaagaagaccctctcccagctcagcgtgcag
gaagacgtgaagatctaa

DBGET integrated database retrieval system