KEGG   Homo sapiens (human): 91Help
Entry
91                CDS       T01001                                 

Gene name
ACVR1B, ACTRIB, ACVRLK4, ALK4, SKR2
Definition
activin A receptor, type IB (EC:2.7.11.30)
Orthology
K13567  
activin receptor type-1B [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:hsa04350]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13
AA seq 505 aa AA seqDB search
MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLD
GMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPS
MWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQ
DLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSRE
ERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVT
IEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRH
DAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSG
GVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQSYEALRVMGKMMRECWYAN
GAARLTALRIKKTLSQLSVQEDVKI
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtcggccggagcctcctccttcttcccccttgttgtcctcctgctcgccggc
agcggcgggtccgggccccggggggtccaggctctgctgtgtgcgtgcaccagctgcctc
caggccaactacacgtgtgagacagatggggcctgcatggtttccattttcaatctggat
gggatggagcaccatgtgcgcacctgcatccccaaagtggagctggtccctgccgggaag
cccttctactgcctgagctcggaggacctgcgcaacacccactgctgctacactgactac
tgcaacaggatcgacttgagggtgcccagtggtcacctcaaggagcctgagcacccgtcc
atgtggggcccggtggagctggtaggcatcatcgccggcccggtgttcctcctgttcctc
atcatcatcattgttttccttgtcattaactatcatcagcgtgtctatcacaaccgccag
agactggacatggaagatccctcatgtgagatgtgtctctccaaagacaagacgctccag
gatcttgtctacgatctctccacctcagggtctggctcagggttacccctctttgtccag
cgcacagtggcccgaaccatcgttttacaagagattattggcaagggtcggtttggggaa
gtatggcggggccgctggaggggtggtgatgtggctgtgaaaatattctcttctcgtgaa
gaacggtcttggttcagggaagcagagatataccagacggtcatgctgcgccatgaaaac
atccttggatttattgctgctgacaataaagataatggcacctggacacagctgtggctt
gtttctgactatcatgagcacgggtccctgtttgattatctgaaccggtacacagtgaca
attgaggggatgattaagctggccttgtctgctgctagtgggctggcacacctgcacatg
gagatcgtgggcacccaagggaagcctggaattgctcatcgagacttaaagtcaaagaac
attctggtgaagaaaaatggcatgtgtgccatagcagacctgggcctggctgtccgtcat
gatgcagtcactgacaccattgacattgccccgaatcagagggtggggaccaaacgatac
atggcccctgaagtacttgatgaaaccattaatatgaaacactttgactcctttaaatgt
gctgatatttatgccctcgggcttgtatattgggagattgctcgaagatgcaattctgga
ggagtccatgaagaatatcagctgccatattacgacttagtgccctctgacccttccatt
gaggaaatgcgaaaggttgtatgtgatcagaagctgcgtcccaacatccccaactggtgg
cagagttatgaggcactgcgggtgatggggaagatgatgcgagagtgttggtatgccaac
ggcgcagcccgcctgacggccctgcgcatcaagaagaccctctcccagctcagcgtgcag
gaagacgtgaagatctaa

DBGET integrated database retrieval system