KEGG   Homo sapiens (human): 910Help
Entry
910               CDS       T01001                                 

Gene name
CD1B, CD1, CD1A, R1
Definition
CD1b molecule
Orthology
K06448  
CD1 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    910 (CD1B)
Cellular antigens [BR:hsa04090]
 Proteins
  910 (CD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23.1
AA seq 333 aa AA seqDB search
MLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDS
DSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGC
ELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILL
YETCPRYLLGVLNAGKADLQRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMR
GEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCRVKHSSLEGQDIILYWRNPTS
IGSIVLAIIVPSLLLLLCLALWYMRRRSYQNIP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgccatttcaactgttagctgttctctttcctggtggtaacagtgaacat
gccttccaggggccgacctcctttcatgttatccagacctcgtcctttaccaatagtacc
tgggcacaaactcaaggctcaggctggttggatgatttgcagattcatggctgggatagc
gactcaggcactgccatattcctgaagccttggtctaaaggtaactttagtgataaggag
gttgctgagttagaggagatattccgagtctacatctttggattcgctcgagaagtacaa
gactttgccggtgatttccagatgaaatacccctttgagatccagggcatagcaggctgt
gagctacattctggaggtgccatagtaagcttcctgaggggagctctaggaggattggat
ttcctgagtgtcaagaatgcttcatgtgtgccttccccagaaggtggcagcagggcacag
aaattctgtgcactaatcatacaatatcaaggtatcatggaaactgtgagaattctcctc
tatgaaacctgcccccgatatctcttgggcgtcctcaatgcaggaaaagcagatctgcaa
agacaagtgaagcctgaggcctggctgtccagtggccccagtcctggacctggccgtctg
cagcttgtgtgccatgtctcaggattctacccaaagcccgtgtgggtgatgtggatgcgg
ggtgagcaggagcagcagggcactcagctaggggacatcctgcccaatgctaactggaca
tggtatctccgagcaaccctggatgtggcagatggggaggcggctggcctgtcctgtcgg
gtgaagcacagcagtttagagggccaggacatcatcctctactggagaaaccccacctcc
attggctcaattgttttggcaataatagtgccttccttgctccttttgctatgccttgca
ttatggtatatgaggcgccggtcatatcagaatatcccatga

DBGET integrated database retrieval system