KEGG   Homo sapiens (human): 910Help
Entry
910               CDS       T01001                                 

Gene name
CD1B, CD1, CD1A, R1
Definition
CD1b molecule
Orthology
K06448  
CD1 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Hematopoietic cell lineage
Class
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23.1
AA seq 333 aa AA seqDB search
MLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDS
DSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGC
ELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILL
YETCPRYLLGVLNAGKADLQRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMR
GEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCRVKHSSLEGQDIILYWRNPTS
IGSIVLAIIVPSLLLLLCLALWYMRRRSYQNIP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgccatttcaactgttagctgttctctttcctggtggtaacagtgaacat
gccttccaggggccgacctcctttcatgttatccagacctcgtcctttaccaatagtacc
tgggcacaaactcaaggctcaggctggttggatgatttgcagattcatggctgggatagc
gactcaggcactgccatattcctgaagccttggtctaaaggtaactttagtgataaggag
gttgctgagttagaggagatattccgagtctacatctttggattcgctcgagaagtacaa
gactttgccggtgatttccagatgaaatacccctttgagatccagggcatagcaggctgt
gagctacattctggaggtgccatagtaagcttcctgaggggagctctaggaggattggat
ttcctgagtgtcaagaatgcttcatgtgtgccttccccagaaggtggcagcagggcacag
aaattctgtgcactaatcatacaatatcaaggtatcatggaaactgtgagaattctcctc
tatgaaacctgcccccgatatctcttgggcgtcctcaatgcaggaaaagcagatctgcaa
agacaagtgaagcctgaggcctggctgtccagtggccccagtcctggacctggccgtctg
cagcttgtgtgccatgtctcaggattctacccaaagcccgtgtgggtgatgtggatgcgg
ggtgagcaggagcagcagggcactcagctaggggacatcctgcccaatgctaactggaca
tggtatctccgagcaaccctggatgtggcagatggggaggcggctggcctgtcctgtcgg
gtgaagcacagcagtttagagggccaggacatcatcctctactggagaaaccccacctcc
attggctcaattgttttggcaataatagtgccttccttgctccttttgctatgccttgca
ttatggtatatgaggcgccggtcatatcagaatatcccatga

DBGET integrated database retrieval system