KEGG   Homo sapiens (human): 9101Help
Entry
9101              CDS       T01001                                 

Gene name
USP8, HumORF8, SPG59, UBPY
Definition
ubiquitin specific peptidase 8 (EC:3.4.19.12)
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    9101 (USP8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     9101 (USP8)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   9101 (USP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q21.2
AA seq 1118 aa AA seqDB search
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAY
VLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRK
KLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEK
GAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLP
DDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGG
YENWLLCYPQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESIPSKPAAQTPPASIEVDE
NIELISGQNERMGPLNISTPVEPVAASKSDVSPIIQPVPSIKNVPQIDRTKKPAVKLPEE
HRIKSESTNHEQQSPQSGKVIPDRSTKPVVFSPTLMLTDEEKARIHAETALLMEKNKQEK
ELRERQQEEQKEKLRKEEQEQKAKKKQEAEENEITEKQQKAKEEMEKKESEQAKKEDKET
SAKRGKEITGVKRQSKSEHETSDAKKSVEDRGKRCPTPEIQKKSTGDVPHTSVTGDSGSG
KPFKIKGQPESGILRTGTFREDTDDTERNKAQREPLTRARSEEMGRIVPGLPSGWAKFLD
PITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAKPQIPAERDREPSKLKRSYSSP
DITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLR
NLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTG
QYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDH
LDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTS
KCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRW
KQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRW
FKFDDHEVSDISVSSVKSSAAYILFYTSLGPRVTDVAT
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtggcttcagttcctaaagaactctacctcagttcttcactaaaagacctt
aataagaagacagaagttaaaccagagaaaataagcactaagagttatgtgcacagtgcc
ctgaagatctttaagacagcagaagaatgcagattagatcgtgatgaggaaagggcctat
gtactatatatgaaatacgtgactgtttataatcttatcaaaaaaagacctgatttcaag
caacagcaggattatttccattcaatacttggacctggaaacatcaaaaaagctgtcgaa
gaagctgaaagactctctgaaagccttaaattaagatatgaagaagctgaagtccggaaa
aaacttgaggaaaaagacaggcaggaggaagcacagcggctacaacaaaaaaggcaggaa
acaggaagagaggatggtggcacattggctaaaggctctttggagaatgttttggattcc
aaagacaaaacccaaaagagcaatggtgaaaagaatgaaaaatgtgagaccaaagagaaa
ggagcaatcacagcaaaggaactatacacaatgatgacggataaaaacatcagcttgatt
ataatggatgctcgaagaatgcaggattatcaggattcctgtattttacattctctcagt
gttcctgaagaagccatcagtccaggagtcactgctagttggattgaagcacacctgcca
gatgattctaaagacacatggaagaagagggggaatgtggagtatgtggtacttcttgac
tggtttagttctgccaaagatttacagattggaacaactctccggagtctgaaagatgca
cttttcaagtgggaaagtaaaactgtcctgcgcaatgagcctttggttttagagggaggc
tatgaaaactggctcctttgttatccccagtatacaacaaatgctaaggtcactccaccc
ccacgacgccagaatgaagaggtgtctatctcattggattttacttatccctcattggaa
gaatcaattccttctaaacctgctgcccagacgccacctgcatctatagaagtagatgaa
aatatagaattgataagtggtcaaaatgagagaatgggaccactgaatatatcaactcca
gttgaaccagttgctgcttctaaatctgatgtttcacccataattcagccagtgcctagt
ataaagaatgttccacagattgatcgtactaaaaaaccagcagtcaaattgcctgaagag
catagaataaaatctgaaagtacaaaccatgagcaacaatctcctcagagtggaaaagtt
attcctgatcgttccaccaagccagtagttttttctccaactctcatgttaacagatgaa
gaaaaggctcgtattcatgcagaaactgctcttctaatggaaaaaaacaaacaagaaaaa
gaacttcgggaaaggcagcaagaggaacagaaagagaaactgaggaaggaagaacaagaa
caaaaagccaaaaagaaacaagaagctgaagaaaatgaaattacagagaagcaacaaaaa
gcaaaagaagaaatggagaagaaagaaagtgaacaggccaagaaagaagataaagaaacc
tcagcaaagaggggcaaagaaataacaggagtaaaaagacaaagtaaaagtgaacatgaa
acttctgatgccaagaaatctgtagaagatagggggaaaaggtgtccaaccccagaaata
cagaaaaagtcaacaggagatgtgccccatacatctgtgacaggggattcaggttcaggc
aagccatttaagattaaaggacaaccagaaagtggaattctaaggacaggaacttttaga
gaggatacagacgataccgaaagaaataaagctcaacgagaacctttgacaagagcacga
agtgaagaaatggggaggatcgtaccaggactgccttcaggctgggccaagtttcttgac
ccaatcactggaacctttcgttattatcattcacccaccaacactgttcatatgtaccca
ccggaaatggctccttcatctgcacctccttccacccctccaactcataaagccaagcca
cagattcctgctgagcgggatagggaaccttccaaactgaagcgctcctactcctcccca
gatataacccaggctattcaagaggaagagaagaggaagccaacagtaactccaacagtt
aatcgggaaaacaagccaacatgttatcctaaagctgagatctcaaggctttctgcttct
cagattcggaacctcaatcctgtttttggaggttctggaccagctcttactggacttcgt
aacttaggaaatacttgttatatgaactcaatattgcagtgcctatgtaacgctccacat
ttggctgattatttcaaccgaaactgttatcaggatgatattaacaggtcaaatttgttg
gggcataaaggtgaagtggcagaagaatttggtataatcatgaaagccctgtggacagga
cagtatagatatatcagtccaaaggactttaaaatcaccattgggaagatcaatgaccag
tttgcaggatacagtcagcaagattcacaagaattgcttctgttcctaatggatggtctc
catgaagatctaaataaagctgataatcggaagagatataaagaagaaaataatgatcat
ctcgatgactttaaagctgcagaacatgcctggcagaaacacaagcagctcaatgagtct
attattgttgcactttttcagggtcaattcaaatctacagtacagtgcctcacatgtcac
aaaaagtctaggacatttgaggccttcatgtatttgtctctaccactagcatccacaagt
aaatgtacattacaggattgccttagattattttccaaagaagaaaaactcacagataac
aacagattttactgcagtcattgcagagctcgacgggattctctaaaaaagatagaaatc
tggaagttaccacctgtgcttttagtgcatctgaaacgtttttcctacgatggcaggtgg
aaacaaaaattacagacatctgtggacttcccgttagaaaatcttgacttgtcacagtat
gttattggtccaaagaacaatttgaagaaatataatttgttttctgtttcaaatcactac
ggtgggctggatggaggccactacacagcctattgtaaaaatgcagcaagacaacggtgg
tttaagtttgatgatcatgaagtttctgatatctccgtttcttctgtgaaatcttcagca
gcttatatcctcttttatacttcattgggaccacgagtaactgatgtagccacataa

DBGET integrated database retrieval system