KEGG   Homo sapiens (human): 9103Help
Entry
9103              CDS       T01001                                 

Gene name
FCGR2C, CD32, CD32C, CDW32, FCG2, FCRIIC, IGFR2
Definition
(RefSeq) Fc fragment of IgG receptor IIc (gene/pseudogene)
  KO
K16824  low affinity immunoglobulin gamma Fc receptor II-c
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04380  Osteoclast differentiation
hsa05140  Leishmaniasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
Disease
H01240  Immune thrombocytopenia (ITP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    9103 (FCGR2C)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    9103 (FCGR2C)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    9103 (FCGR2C)
   05152 Tuberculosis
    9103 (FCGR2C)
   05140 Leishmaniasis
    9103 (FCGR2C)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    9103 (FCGR2C)
CD molecules [BR:hsa04090]
 Proteins
  9103 (FCGR2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set V-set Ig_5 C2-set_2 DUF3827 Protocadherin CD34_antigen Adeno_E3_CR2 V-set_CD47 ECSCR
Motif
Other DBs
NCBI-GeneID: 9103
NCBI-ProteinID: NP_963857
OMIM: 612169
HGNC: 15626
Pharos: P31995(Tbio)
UniProt: P31995
Position
1q23.3
AA seq 323 aa AA seqDB search
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL
SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA
VVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPR
APTDDDKNIYLTLPPNDHVNSNN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcctgtcattcttacctgtccttgccactgagagtgactgggctgactgcaag
tccccccagccttggggtcatatgcttctgtggacagctgtgctattcctggctcctgtt
gctgggacacctgcagctcccccaaaggctgtgctgaaactcgagccccagtggatcaac
gtgctccaagaggactctgtgactctgacatgccgggggactcacagccctgagagcgac
tccattccgtggttccacaatgggaatctcattcccacccacacgcagcccagctacagg
ttcaaggccaacaacaatgacagcggggagtacacgtgccagactggccagaccagcctc
agcgaccctgtgcatctgactgtgctttctgagtggctggtgctccagacccctcacctg
gagttccaggagggagaaaccatcgtgctgaggtgccacagctggaaggacaagcctctg
gtcaaggtcacattcttccagaatggaaaatccaagaaattttcccgttcggatcccaac
ttctccatcccacaagcaaaccacagtcacagtggtgattaccactgcacaggaaacata
ggctacacgctgtactcatccaagcctgtgaccatcactgtccaagctcccagctcttca
ccgatggggatcattgtggctgtggtcactgggattgctgtagcggccattgttgctgct
gtagtggccttgatctactgcaggaaaaagcggatttcagccaattccactgatcctgtg
aaggctgcccaatttgagccacctggacgtcaaatgattgccatcagaaagagacaacct
gaagaaaccaacaatgactatgaaacagctgacggcggctacatgactctgaaccccagg
gcacctactgacgatgataaaaacatctacctgactcttcctcccaacgaccatgtcaac
agtaataactaa

DBGET integrated database retrieval system