KEGG   Homo sapiens (human): 9103Help
Entry
9103              CDS       T01001                                 

Gene name
FCGR2C, CD32, CD32C, CDW32, FCG2, FCRIIC, IGFR2
Definition
Fc fragment of IgG, low affinity IIc, receptor for (CD32) (gene/pseudogene)
Orthology
K16824  
low affinity immunoglobulin gamma Fc region receptor II-c
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Osteoclast differentiation
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Disease
H01240  
Immune thrombocytopenia (ITP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    9103 (FCGR2C)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    9103 (FCGR2C)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    9103 (FCGR2C)
   05152 Tuberculosis
    9103 (FCGR2C)
   05140 Leishmaniasis
    9103 (FCGR2C)
Cellular antigens [BR:hsa04090]
 Proteins
  9103 (FCGR2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23.3
AA seq 323 aa AA seqDB search
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL
SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA
VVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPR
APTDDDKNIYLTLPPNDHVNSNN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcctgtcattcttacctgtccttgccactgagagtgactgggctgactgcaag
tccccccagccttggggtcatatgcttctgtggacagctgtgctattcctggctcctgtt
gctgggacacctgcagctcccccaaaggctgtgctgaaactcgagccccagtggatcaac
gtgctccaagaggactctgtgactctgacatgccgggggactcacagccctgagagcgac
tccattccgtggttccacaatgggaatctcattcccacccacacgcagcccagctacagg
ttcaaggccaacaacaatgacagcggggagtacacgtgccagactggccagaccagcctc
agcgaccctgtgcatctgactgtgctttctgagtggctggtgctccagacccctcacctg
gagttccaggagggagaaaccatcgtgctgaggtgccacagctggaaggacaagcctctg
gtcaaggtcacattcttccagaatggaaaatccaagaaattttcccgttcggatcccaac
ttctccatcccacaagcaaaccacagtcacagtggtgattaccactgcacaggaaacata
ggctacacgctgtactcatccaagcctgtgaccatcactgtccaagctcccagctcttca
ccgatggggatcattgtggctgtggtcactgggattgctgtagcggccattgttgctgct
gtagtggccttgatctactgcaggaaaaagcggatttcagccaattccactgatcctgtg
aaggctgcccaatttgagccacctggacgtcaaatgattgccatcagaaagagacaacct
gaagaaaccaacaatgactatgaaacagctgacggcggctacatgactctgaaccccagg
gcacctactgacgatgataaaaacatctacctgactcttcctcccaacgaccatgtcaac
agtaataactaa

DBGET integrated database retrieval system