KEGG   Homo sapiens (human): 91039Help
Entry
91039             CDS       T01001                                 

Gene name
DPP9, DP9, DPLP9, DPRP-2, DPRP2
Definition
(RefSeq) dipeptidyl peptidase 9 (EC:3.4.14.5)
  KO
K08656  
dipeptidyl-peptidase 9 [EC:3.4.14.5]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.5  dipeptidyl-peptidase IV
     91039 (DPP9)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   91039 (DPP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 892 aa AA seqDB search
MRKVKKLRLDKENTGSWRSFSLNSEGAERMATTGTPTADRGDAAATDDPAARFQVQKHSW
DGLRSIIHGSRKYSGLIVNKAPHDFQFVQKTDESGPHSHRLYYLGMPYGSRENSLLYSEI
PKKVRKEALLLLSWKQMLDHFQATPHHGVYSREEELLRERKRLGVFGITSYDFHSESGLF
LFQASNSLFHCRDGGKNGFMVSPMKPLEIKTQCSGPRMDPKICPADPAFFSFINNSDLWV
ANIETGEERRLTFCHQGLSNVLDDPKSAGVATFVIQEEFDRFTGYWWCPTASWEGSEGLK
TLRILYEEVDESEVEVIHVPSPALEERKTDSYRYPRTGSKNPKIALKLAEFQTDSQGKIV
STQEKELVQPFSSLFPKVEYIARAGWTRDGKYAWAMFLDRPQQWLQLVLLPPALFIPSTE
NEEQRLASARAVPRNVQPYVVYEEVTNVWINVHDIFYPFPQSEGEDELCFLRANECKTGF
CHLYKVTAVLKSQGYDWSEPFSPGEDEFKCPIKEEIALTSGEWEVLARHGSKIWVNEETK
LVYFQGTKDTPLEHHLYVVSYEAAGEIVRLTTPGFSHSCSMSQNFDMFVSHYSSVSTPPC
VHVYKLSGPDDDPLHKQPRFWASMMEAASCPPDYVPPEIFHFHTRSDVRLYGMIYKPHAL
QPGKKHPTVLFVYGGPQVQLVNNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEG
ALKNQMGQVEIEDQVEGLQFVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVAI
AGAPVTVWMAYDTGYTERYMDVPENNQHGYEAGSVALHVEKLPNEPNRLLILHGFLDENV
HFFHTNFLVSQLIRAGKPYQLQIYPNERHSIRCPESGEHYEVTLLHFLQEYL
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaggttaagaaactgcgcctggacaaggagaacaccggaagttggagaagcttc
tcgctgaattccgagggggctgagaggatggccaccaccgggaccccaacggccgaccga
ggcgacgcagccgccacagatgacccggccgcccgcttccaggtgcagaagcactcgtgg
gacgggctccggagcatcatccacggcagccgcaagtactcgggcctcattgtcaacaag
gcgccccacgacttccagtttgtgcagaagacggatgagtctgggccccactcccaccgc
ctctactacctgggaatgccatatggcagccgagagaactccctcctctactctgagatt
cccaagaaggtccggaaagaggctctgctgctcctgtcctggaagcagatgctggatcat
ttccaggccacgccccaccatggggtctactctcgggaggaggagctgctgagggagcgg
aaacgcctgggggtcttcggcatcacctcctacgacttccacagcgagagtggcctcttc
ctcttccaggccagcaacagcctcttccactgccgcgacggcggcaagaacggcttcatg
gtgtcccctatgaaaccgctggaaatcaagacccagtgctcagggccccggatggacccc
aaaatctgccctgccgaccctgccttcttctccttcatcaataacagcgacctgtgggtg
gccaacatcgagacaggcgaggagcggcggctgaccttctgccaccaaggtttatccaat
gtcctggatgaccccaagtctgcgggtgtggccaccttcgtcatacaggaagagttcgac
cgcttcactgggtactggtggtgccccacagcctcctgggaaggttcagagggcctcaag
acgctgcgaatcctgtatgaggaagtcgatgagtccgaggtggaggtcattcacgtcccc
tctcctgcgctagaagaaaggaagacggactcgtatcggtaccccaggacaggcagcaag
aatcccaagattgccttgaaactggctgagttccagactgacagccagggcaagatcgtc
tcgacccaggagaaggagctggtgcagcccttcagctcgctgttcccgaaggtggagtac
atcgccagggccgggtggacccgggatggcaaatacgcctgggccatgttcctggaccgg
ccccagcagtggctccagctcgtcctcctccccccggccctgttcatcccgagcacagag
aatgaggagcagcggctagcctctgccagagctgtccccaggaatgtccagccgtatgtg
gtgtacgaggaggtcaccaacgtctggatcaatgttcatgacatcttctatcccttcccc
caatcagagggagaggacgagctctgctttctccgcgccaatgaatgcaagaccggcttc
tgccatttgtacaaagtcaccgccgttttaaaatcccagggctacgattggagtgagccc
ttcagccccggggaagatgaatttaagtgccccattaaggaagagattgctctgaccagc
ggtgaatgggaggttttggcgaggcacggctccaagatctgggtcaatgaggagaccaag
ctggtgtacttccagggcaccaaggacacgccgctggagcaccacctctacgtggtcagc
tatgaggcggccggcgagatcgtacgcctcaccacgcccggcttctcccatagctgctcc
atgagccagaacttcgacatgttcgtcagccactacagcagcgtgagcacgccgccctgc
gtgcacgtctacaagctgagcggccccgacgacgaccccctgcacaagcagccccgcttc
tgggctagcatgatggaggcagccagctgccccccggattatgttcctccagagatcttc
catttccacacgcgctcggatgtgcggctctacggcatgatctacaagccccacgccttg
cagccagggaagaagcaccccaccgtcctctttgtatatggaggcccccaggtgcagctg
gtgaataactccttcaaaggcatcaagtacttgcggctcaacacactggcctccctgggc
tacgccgtggttgtgattgacggcaggggctcctgtcagcgagggcttcggttcgaaggg
gccctgaaaaaccaaatgggccaggtggagatcgaggaccaggtggagggcctgcagttc
gtggccgagaagtatggcttcatcgacctgagccgagttgccatccatggctggtcctac
gggggcttcctctcgctcatggggctaatccacaagccccaggtgttcaaggtggccatc
gcgggtgccccggtcaccgtctggatggcctacgacacagggtacactgagcgctacatg
gacgtccctgagaacaaccagcacggctatgaggcgggttccgtggccctgcacgtggag
aagctgcccaatgagcccaaccgcttgcttatcctccacggcttcctggacgaaaacgtg
cactttttccacacaaacttcctcgtctcccaactgatccgagcagggaaaccttaccag
ctccagatctaccccaacgagagacacagtattcgctgccccgagtcgggcgagcactat
gaagtcacgttgctgcactttctacaggaatacctctga

DBGET integrated database retrieval system