KEGG   Homo sapiens (human): 9104Help
Entry
9104              CDS       T01001                                 

Gene name
RGN, GNL, HEL-S-41, RC, SMP30
Definition
regucalcin (EC:3.1.1.17)
Orthology
K01053  
gluconolactonase [EC:3.1.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose phosphate pathway
Ascorbate and aldarate metabolism
Metabolic pathways
Carbon metabolism
Degradation of aromatic compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Overview; Degradation of aromatic compounds [PATH:hsa01220]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:hsa00030]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:hsa00053]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.3
AA seq 246 aa AA seqDB search
MDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRY
FAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSY
SVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGK
RLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIA
PYSYAG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggatgccccagtcagctccgtggctcttcgccagtcgggaggctatgttgccaccatt
ggaacaaagttctgtgctttgaactggaaagaacaatcagcagttgtcttggccacggtg
gataacgacaagaaaaacaatcgcttcaatgatgggaaggtggatcccgccgggaggtac
tttgctggcaccatggctgaggaaacagctccagcagttcttgagcggcaccagggggcc
ctgtactccctctttcctgatcaccacgtgaaaaagtactttgaccaggtggacatttcc
aatggtttggattggtcgctagaccacaaaatcttctattacattgacagcctgtcctac
tccgtggatgcctttgactatgacctgcagacaggacagatctccaaccgcagaagtgtt
tacaagctagaaaaggaagaacaaatcccagatggaatgtgtattgatgctgaggggaag
ctctgggtggcctgttacaatggaggaagagtgattcgtttagatcctgtgacagggaaa
agacttcaaactgtgaagttgcctgttgataaaacaacttcatgctgctttggagggaag
aattactctgaaatgtatgtgacctgcgcccgggatgggatggaccccgagggtcttttg
aggcaacctgaagctggtggaattttcaagataactggtctgggggtcaaaggaattgct
ccctactcctatgcgggatga

DBGET integrated database retrieval system