KEGG   Homo sapiens (human): 9104Help
Entry
9104              CDS       T01001                                 

Gene name
RGN, GNL, HEL-S-41, RC, SMP30
Definition
(RefSeq) regucalcin (EC:3.1.1.17)
  KO
K01053  
gluconolactonase [EC:3.1.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose phosphate pathway
Ascorbate and aldarate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    9104 (RGN)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    9104 (RGN)
   00053 Ascorbate and aldarate metabolism
    9104 (RGN)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.17  gluconolactonase
     9104 (RGN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9104 (RGN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.3
AA seq 299 aa AA seqDB search
MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSS
VALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAE
ETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDY
DLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKL
PVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccattaagattgagtgtgttttgccagagaactgccggtgtggtgagtctcca
gtatgggaggaagtgtccaactctctgctctttgtagacattcctgcaaaaaaggtttgc
cggtgggattcattcaccaagcaagtacagcgagtgaccatggatgccccagtcagctcc
gtggctcttcgccagtcgggaggctatgttgccaccattggaacaaagttctgtgctttg
aactggaaagaacaatcagcagttgtcttggccacggtggataacgacaagaaaaacaat
cgcttcaatgatgggaaggtggatcccgccgggaggtactttgctggcaccatggctgag
gaaacagctccagcagttcttgagcggcaccagggggccctgtactccctctttcctgat
caccacgtgaaaaagtactttgaccaggtggacatttccaatggtttggattggtcgcta
gaccacaaaatcttctattacattgacagcctgtcctactccgtggatgcctttgactat
gacctgcagacaggacagatctccaaccgcagaagtgtttacaagctagaaaaggaagaa
caaatcccagatggaatgtgtattgatgctgaggggaagctctgggtggcctgttacaat
ggaggaagagtgattcgtttagatcctgtgacagggaaaagacttcaaactgtgaagttg
cctgttgataaaacaacttcatgctgctttggagggaagaattactctgaaatgtatgtg
acctgcgcccgggatgggatggaccccgagggtcttttgaggcaacctgaagctggtgga
attttcaagataactggtctgggggtcaaaggaattgctccctactcctatgcgggatga

DBGET integrated database retrieval system