KEGG   Homo sapiens (human): 9110Help
Entry
9110              CDS       T01001                                 

Gene name
MTMR4, FYVE-DSP2, ZFYVE11
Definition
(RefSeq) myotubularin related protein 4 (EC:3.1.3.48)
  KO
K18082  
myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    9110 (MTMR4)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    9110 (MTMR4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     9110 (MTMR4)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     9110 (MTMR4)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     9110 (MTMR4)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    9110 (MTMR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q22
AA seq 1195 aa AA seqDB search
MGEEGPPSLEYIQAKDLFPPKELVKEEENLQVPFTVLQGEGVEFLGRAADALIAISNYRL
HIKFKDSVINVPLRMIDSVESRDMFQLHISCKDSKVVRCHFSTFKQCQEWLSRLSRATAR
PAKPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEHIRCRQEAELARMGFDLQNVWRVSHIN
SNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRNGAAIARCSQPEISW
WGWRNADDEYLVTSIAKACALDPGTRATGGSLSTGNNDTSEACDADFDSSLTACSGVEST
AAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMANIHAIRNSFQYLRAVC
SQMPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDREGRPVLVHCSDGWDRTPQIVAL
AKILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENVEDQNEQCPVFLQWLDSVHQL
LKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREKRNIYKRTCSVWALLRAGNKN
FHNFLYTPSSDMVLHPVCHVRALHLWTAVYLPASSPCTLGEENMDLYLSPVAQSQEFSGR
SLDRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNNHCQEVRVGLEPWHSNPEGSETSFVD
SGVGGPQQTVGEVGLPPPLPSSQKDYLSNKPFKSHKSCSPSYKLLNTAVPREMKSNTSDP
EIKVLEETKGPAPDPSAQDELGRTLDGIGEPPEHCPETEAVSALSKVISNKCDGVCNFPE
SSQNSPTGTPQQAQPDSMLGVPSKCVLDHSLSTVCNPPSAACQTPLDPSTDFLNQDPSGS
VASISHQEQLSSVPDLTHGEEDIGKRGNNRNGQLLENPRFGKMPLELVRKPISQSQISEF
SFLGSNWDSFQGMVTSFPSGEATPRRLLSYGCCSKRPNSKQMRATGPCFGGQWAQREGVK
SPVCSSHSNGHCTGPGGKNQMWLSSHPKQVSSTKPVPLNCPSPVPPLYLDDDGLPFPTDV
IQHRLRQIEAGYKQEVEQLRRQVRELQMRLDIRHCCAPPAEPPMDYEDDFTCLKESDGSD
TEDFGSDHSEDCLSEASWEPVDKKETEVTRWVPDHMASHCYNCDCEFWLAKRRHHCRNCG
NVFCAGCCHLKLPIPDQQLYDPVLVCNSCYEHIQVSRARELMSQQLKKPIATASS
NT seq 3588 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaggaggggccccccagcctggagtacatccaagccaaggatctgttccccccc
aaggaactagtgaaggaggaagagaatcttcaggtccccttcacagtgctgcagggtgag
ggagtagagttcctgggccgggcagccgatgccctcattgccatctctaactaccggctg
catatcaaattcaaggactctgtcatcaacgtccccctccggatgattgacagtgtggag
agccgtgatatgttccagttgcacatttcctgcaaggactccaaagtggtgaggtgccac
ttctccacttttaagcagtgccaagagtggctctcacggctaagccgagccacagcaaga
cctgccaagcctgaagacctctttgcctttgcctaccatgcctggtgcctggggctgacc
gaggaggaccagcacactcacctatgtcagccaggtgagcacatacgttgtcgacaggag
gcggagcttgcaaggatgggctttgacctgcagaacgtctggagagtctcacacatcaac
agcaactacaaattgtgccccagttacccccagaagctgctggttcctgtgtggatcact
gacaaagagctggagaacgtggcttccttccgctcctggaagcggattcccgtggttgtg
tatagacacttgcgcaatggggctgccatcgcccgctgcagccagccagagatcagctgg
tggggctggcgcaatgctgatgatgagtacctggtcacgtccattgctaaagcctgtgcc
ctggacccggggacaagggccactgggggctccctcagcaccgggaataatgataccagc
gaggcgtgtgatgctgactttgattcttctctgactgcgtgctctggagtggagagcaca
gcagctcctcaaaagctgctgatcctggatgcgcgatcctacacggcagcagtggccaac
cgggccaagggtggaggctgtgaatgtgaagagtactatcccaactgtgaggtcgtgttc
atgggaatggccaacatccatgccatccggaacagctttcagtacctccgggctgtgtgt
agccagatgccggatcctagcaactggttgtcggcactggagagtaccaaatggctgcag
cacttgtcggtgatgctaaaagcagctgtgctggtggctaatacagtagaccgggaaggc
cggcctgtgctggtacactgctcagatggctgggaccgcacaccgcagatcgtagccctg
gccaaaatattactggacccatattacaggacgttggagggcttccaagtgttagtggag
tctgactggctggattttgggcacaagtttggagatcgctgtggccaccaagagaatgtg
gaggaccaaaacgaacaatgccctgtgttcctccagtggcttgattctgttcatcagttg
cttaagcagttcccctgcctgtttgaatttaatgaagcattcctggtaaaactggtgcaa
cacacatactcctgcctctacggcaccttcctggccaacaacccctgtgagcgagagaag
cgcaacatctacaagcggacctgctctgtgtgggcgctccttcgagctggcaataaaaac
tttcataacttcctctacacacccagctcagacatggtcctgcatcctgtttgtcatgtc
cgggccctgcacctctggacagctgtttatctgccagcatcatctccatgcacacttggg
gaagaaaacatggatctttacctttccccagtggcccagagccaggagttctctggccgc
tctctggacagattacctaaaaccagatccatggatgatcttctttctgcctgtgacaca
agcagccccctgactcgtacatccagtgaccctaacctgaataaccactgtcaggaggtc
agggtaggcctggagccctggcacagcaatcctgagggatcagagacaagctttgtggac
tctggggtaggagggcctcagcaaactgtaggagaagtgggtcttcctcctcctctgccc
agcagccagaaagactacttgagcaataaacctttcaagagtcacaaaagctgttctcca
agttacaaactgcttaataccgcagtgcctcgggaaatgaagagcaacacctctgatcct
gagatcaaagtcctagaagagactaagggaccagctccagacccttctgcccaggatgag
ctgggtaggactttagatggcataggggagccacctgaacattgtcctgaaacagaagct
gtcagtgcactctccaaggtcatttctaacaagtgtgatggagtttgtaattttcctgag
tcttcccagaactctcctacaggtacgccccaacaggcccagccagactccatgctaggt
gtgccctccaagtgtgttcttgatcacagcctcagcaccgtttgcaacccaccgagtgct
gcctgccaaactcctctagacccaagcactgacttcctcaaccaagatccctcagggtct
gtggcaagtatctcccaccaggaacaactgagttctgtgccggatctgacccatggggag
gaagacattggtaaaagaggaaataataggaatgggcagttattggaaaatcctcgcttt
gggaaaatgccattggaattggtccggaagccaatttctcagagccagatcagtgagttc
tcttttctagggtccaactgggacagcttccaagggatggtgacttcattcccaagtggg
gaggccacccctcggcggctgctttcctatggctgttgtagcaagaggccaaacagtaag
cagatgcgggccacagggccctgctttgggggccagtgggctcagagagaaggtgtgaag
tcacctgtctgttctagtcattccaatggacattgtactggcccaggaggaaagaaccag
atgtggttgtccagtcatccaaagcaagtctctagcacaaagcccgttccactgaactgc
ccttctccagtgcctcctctgtatttggatgatgatggactcccctttcccacggatgtg
atccagcataggttacggcaaatcgaagcagggtacaaacaagaggtggagcagctacgt
cgacaggtgcgtgagcttcagatgaggctggacatccgtcactgctgtgcccctccagca
gagccccccatggactatgaggatgattttacatgtttgaaggagtcagatggcagtgat
actgaggattttggctctgatcacagtgaagactgcctttcagaagcaagctgggaacct
gttgataagaaagagactgaggtgactcgctgggttccagaccatatggcatcacactgc
tataactgtgactgtgaattctggttggccaaacgaagacaccattgcagaaattgtggg
aatgtattttgtgctggatgctgccacctgaagctgcccattcctgatcagcaactctat
gacccagttctcgtctgtaactcatgttacgaacacattcaagtctctcgtgccagggaa
ctcatgagccaacagctgaagaaacccattgctacagcttccagttga

DBGET integrated database retrieval system