KEGG   Homo sapiens (human): 9114Help
Entry
9114              CDS       T01001                                 

Gene name
ATP6V0D1, ATP6D, ATP6DV, P39, VATX, VMA6, VPATPD
Definition
ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (EC:3.6.3.14)
Orthology
K02146  
V-type H+-transporting ATPase subunit d
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Lysosome
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Tuberculosis
Viral carcinogenesis
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    9114 (ATP6V0D1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    9114 (ATP6V0D1)
   04142 Lysosome
    9114 (ATP6V0D1)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    9114 (ATP6V0D1)
  Nervous system
   04721 Synaptic vesicle cycle
    9114 (ATP6V0D1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    9114 (ATP6V0D1)
  Immune diseases
   05323 Rheumatoid arthritis
    9114 (ATP6V0D1)
  Infectious diseases
   05110 Vibrio cholerae infection
    9114 (ATP6V0D1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    9114 (ATP6V0D1)
   05152 Tuberculosis
    9114 (ATP6V0D1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22.1
AA seq 351 aa AA seqDB search
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLAN
EASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQR
SIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEI
IRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKL
FPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVK
LNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcttcccggagctttactttaacgtggacaatggctacttggagggactggtg
cgcggcctgaaggccggggtgctcagccaggccgactacctcaacctggtgcagtgcgag
acgctagaggacttgaaactgcatctgcagagcactgattatggtaacttcctggccaac
gaggcatcacctctgacggtgtcagtcatcgatgaccggctcaaggagaagatggtggtg
gagttccgccacatgaggaaccatgcctatgagccactcgccagcttcctagacttcatt
acttacagttacatgatcgacaacgtgatcctgctcatcacaggcacgctgcaccagcgc
tccatcgctgagctcgtgcccaagtgccacccactaggcagcttcgagcagatggaggcc
gtgaacattgctcagacacctgctgagctctacaatgccattctggtggacacgcctctt
gcggcttttttccaggactgcatttcagagcaggaccttgacgagatgaacatcgagatc
atccgcaacaccctctacaaggcctacctggagtccttctacaagttctgcaccctactg
ggcgggactacggctgatgccatgtgccccatcctggagtttgaagcagaccgccgcgcc
ttcatcatcaccatcaattctttcggcacagagctgtccaaagaggaccgtgccaagctc
tttccacactgtgggcggctctaccctgagggcctggcgcagctggctcgggctgacgac
tatgaacaggtcaagaacgtggccgattactacccggagtacaagctgctcttcgagggt
gcaggtagcaaccctggagacaagacgctggaggaccgattctttgagcacgaggtaaag
ctgaacaagttggccttcctgaaccagttccactttggtgtcttctatgccttcgtgaag
ctcaaggagcaggagtgtcgcaacatcgtgtggatcgctgaatgtatcgcccagcgccac
cgcgccaaaatcgacaactacatccctatcttctag

DBGET integrated database retrieval system