KEGG   Homo sapiens (human): 91181Help
Entry
91181             CDS       T01001                                 

Gene name
NUP210L
Definition
(RefSeq) nucleoporin 210kDa like
  KO
K14314  
nuclear pore complex protein Nup210
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    91181 (NUP210L)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     91181 (NUP210L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21.3
AA seq 1888 aa AA seqDB search
MTGCPASSRRRGFGLFFFLRLHRLLLLFLVLRGTLANKLNVPQVLLPFGREPGRVPFLLE
AQRGCYTWHSTHHDAVTVEPLYENGTLCSQKAVLIAESTQPIRLSSIILAREIVTDHELR
CDVKVDVINSIEIVSRARELYVDDSPLELMVRALDAEGNTFSSLAGMMFEWSIAQDNESA
REELSSKIRILKYSEAEYAPPIYIAEMEKEEKQGDVILVSGIRTGAAVVKVRIHEPFYKK
VAAALIRLLVLENIFLIPSHDIYLLVGTYIKYQVAKMVQGRVTEVKFPLEHYILELQDHR
VALNGSHSEKVAILDDKTAMVTASQLGQTNLVFVHKNVHMRSVSGLPNCTIYVVEPGFLG
FTVQPGNRWSLEVGQVYVITVDVFDKSSTKVYISDNLRITYDFPKEYFEEQLTTVNGSYH
IVKALKDGVVVINASLTSIIYQNKDIQPIKFLIKHQQEVKIYFPIMLTPKFLAFPHHPMG
MLYRYKVQVEGGSGNFTWTSSNETVVIVTTKGVVTAGQVRGNSTVLARDVQNPFRYGEIK
IHVLKLNKMELLPFHADVEIGQIIEIPIAMYHINKETKEAMAFTDCSHLSLDLNMDKQGV
FTLLKEGIQRPGPMHCSSTHIAAKSLGHTLVTVSVNECDKYLESSATFAAYEPLKALNPV
EVALVTWQSVKEMVFEGGPRPWILEPSRFFLELNAEKTEKIGIAQVWLPSKRKQNQYIYR
IQCLDLGEQVLTFRIGNHPGVLNPSPAVEVLQVRFICAHPASMSVTPVYKVPAGAQPCPL
PQHNKWLIPVSRLRDTVLELAVFDQHRRKFDNFSSLMLEWKSSNETLAHFEDYKSVEMVA
KDDGSGQTRLHGHQILKVHQIKGTVLIGVNFVGYSEKKSPKEISNLPRSVDVELLLVDDV
TVVPENATIYNHPDVKETFSLVEGSGYFLVNSSEQGVVTITYMEAESSVELVPLHPGFFT
LEVYDLCLAFLGPATAHLRVSDIQELELDLIDKVEIDKTVLVTVRVLGSSKRPFQNKYFR
NMELKLQLASAIVTLTPMEQQDEYSENYILRATTIGQTTLVAIAKDKMGRKYTSTPRHIE
VFPPFRLLPEKMTLIPMNMMQVMSEGGPQPQSIVHFSISNQTVAVVNRRGQVTGKIVGTA
VVHGTIQTVNEDTGKVIVFSQDEVQIEVVQLRAVRILAAATRLITATKMPVYVMGVTSTQ
TPFSFSNANPGLTFHWSMSKRDVLDLVPRHSEVFLQLPVEHNFAMVVHTKAAGRTSIKVT
VHCMNSSSGQFEGNLLELSDEVQILVFEKLQLFYPECQPEQILMPINSQLKLHTNREGAA
FVSSRVLKCFPNSSVIEEDGEGLLKAGSIAGTAVLEVTSIEPFGVNQTTITGVQVAPVTY
LRVSSQPKLYTAQGRTLSAFPLGMSLTFTVQFYNSIGEKFHTHNTQLYLALNRDDLLHIG
PGNKNYTYMAQAVNRGLTLVGLWDRRHPGMADYIPVAVEHAIEPDTKLTFVGDIICFSTH
LVSQHGEPGIWMISANNILQTDIVTGVGVARSPGTAMIFHDIPGVVKTYREVVVNASSRL
MLSYDLKTYLTNTLNSTVFKLFITTGRNGVNLKGFCTPNQALAITKVLLPATLMLCHVQF
SNTLLDIPASKVFQVHSDFSMEKGVYVCIIKVRPQSEELLQALSVADTSVYGWATLVSER
SKNGMQRILIPFIPAFYINQSELVLSHKQDIGEIRVLGVDRVLRKLEVISSSPVLVVAGH
SHSPLTPGLAIYSVRVVNFTSFQQMASPVFINISCVLTSQSEAVVVRAMKDKLGADHCED
SAILKRFTGSYQILLLTLFAVLASTASIFLAYNAFLNKIQTVPVVYVPTLGTPQPGFFNS
TSSPPHFMSLQPPLAQSRLQHWLWSIRH
NT seq 5667 nt NT seq  +upstreamnt  +downstreamnt
atgactggctgtccggcgtcatcaagacgccgaggcttcgggctctttttcttcttgcgt
ctacaccgcctcctgttgttgtttctggttttgcgtgggaccctggccaacaaacttaac
gtgccacaggtgttgctacccttcggccgagagccaggccgggtgcctttcctgctggag
gcccagcggggctgctacacttggcattccacccatcatgatgcagttactgttgagcct
ttatatgaaaatggcaccttgtgttcccaaaaagctgtactcattgctgaatctacgcaa
ccgatacgcctcagcagtattattcttgctcgagaaatagtgactgaccatgagctacgc
tgtgatgttaaggttgatgtgataaacagcattgaaattgtatctcgggcccgggaactt
tatgtagatgattcgccactggaactgatggtgagggcattggatgctgaaggaaatact
tttagtagtttggcagggatgatgtttgagtggagcattgcccaggacaacgagtcagca
agagaagaactgtctagcaaaattaggattcttaaatactccgaagcagaatatgctccc
ccaatatatatagctgagatggaaaaagaggagaaacaaggagatgtgattttagtgtct
gggattagaactggtgctgctgttgtaaaagttcgaattcatgaaccattctataagaaa
gtggcagcagccttaatacgtctgcttgttttggagaatatatttcttataccatcccat
gatatttatctcttagtaggaacatatattaaataccaagttgcaaaaatggttcaaggg
agagtgacagaggtgaaatttcccctggaacattatatactggaattgcaagaccataga
gttgcacttaacgggtctcattctgagaaagtggctatactggatgacaaaacagccatg
gtgactgcctcacaactgggccagactaatcttgtctttgtccataaaaatgttcatatg
cgatctgtgtctggactcccaaattgcaccatatatgttgtagagcctggatttttaggt
ttcactgtccaacctggaaaccgatggagtctagaggtgggacaggtatatgtcattaca
gtagacgtctttgataaaagcagcacaaaggtctatatttcagataatctcaggattaca
tacgactttcctaaggagtactttgaagagcaactaactaccgtgaatggatcttaccat
atagtaaaagccctgaaagatggtgttgtggtaataaatgcatccctgacctccatcatt
taccagaataaagatattcagcctataaaatttctaatcaaacaccaacaagaagtgaag
atttattttcccatcatgcttacacccaaatttctggcatttcctcatcatcctatggga
atgttatatcgttataaagtacaggtagagggtggcagtggcaactttacctggacttct
tctaatgaaacagtggtcatagtaaccacgaaaggagtggtgactgcaggtcaggtcagg
gggaatagtactgttttggcccgagatgtacaaaatccctttcgatatggagaaattaag
atacatgtcctgaaactgaacaaaatggaactgttaccatttcatgctgatgtggagatt
ggccagattatagaaatacccattgcaatgtatcacataaataaagagaccaaagaagcc
atggcattcacagactgctctcatttatccttggatctgaacatggataaacaaggagtc
tttactcttctcaaagaaggtattcaaagacctggaccaatgcattgttccagtacacat
atcgcagctaaatctcttggccatactctggtaacagtaagtgtgaatgaatgtgacaag
tacttggagagcagtgctacatttgctgcttatgaacccctaaaggctttaaatcctgtg
gaagtggcattggtgacatggcagtctgtgaaggaaatggtatttgaagggggtcctcgt
ccatggatcttggagccctcccgattttttttggaattgaatgcggagaagacagagaag
attggaatagcacaagtgtggctgccatctaagagaaaacagaaccagtacatctaccgg
atccaatgcctggatttaggggaacaagttctcacattccgaattggaaatcatccaggt
gtcctgaaccctagtccagctgtagaggttttgcaggttcgcttcatttgtgcccaccct
gccagtatgtcagtaactccagtatacaaggtgccagctggtgcccagccatgtcctctg
ccacagcacaacaaatggctgattcctgtatcaagactgagggacacagtcctggaacta
gcagtgtttgatcaacataggagaaagtttgataatttcagttcactaatgctagaatgg
aaatcctccaatgaaacactagcccatttcgaagattataaatcagtggaaatggtagca
aaagatgatggcagtgggcagacccggttacatggtcatcagatccttaaagtacatcag
ataaaagggactgtactgattggagtcaattttgtgggctattcagagaagaaaagccca
aaagaaatttccaacttgcccagatctgtagatgtggaactgctcctggtagatgatgta
actgtagtgcctgagaatgccaccatctataaccaccctgatgtaaaggaaacatttagc
cttgtggaaggatctggttattttttagtcaacagcagtgagcagggtgttgtcaccatc
acttacatggaagcagaaagctctgttgagttagttccattacatcctggattttttacc
ttggaggtctatgatctttgtttggctttcttgggtccagcaacagcccacctcagggtg
tcagacatacaagagctggagcttgatctgattgataaggttgaaatagacaaaactgtg
ttagtgactgtgagggttcttggctcttccaaacgcccattccaaaataaatacttcaga
aacatggaactcaaactgcagttggcttctgccattgtcaccctgacaccaatggagcaa
caggacgaatactctgaaaattatattcttcgagctaccactattgggcaaaccacactt
gtggctattgccaaggacaagatgggaagaaaatacacatcaactcctcggcacattgaa
gtgtttcctccattcagacttcttccagagaaaatgacactgattccaatgaatatgatg
caggtaatgtctgaaggtggcccccagccccaatccatcgttcacttctccatcagtaat
cagaccgtggctgttgttaataggagggggcaagttacagggaagattgttggcacagct
gtggttcatggcaccatccagacagtaaatgaagatactggcaaagtcattgtgttttct
caggatgaagtacagattgaagttgttcagctaagggctgttaggatccttgcagctgca
actcggctcatcacagctaccaagatgccagtttatgtcatgggagtaaccagtacccag
acccctttctccttcagcaatgctaatcctgggctcacattccactggtctatgagcaaa
agggatgtattggatctagtgcccaggcattcagaggtttttctacagctcccagtagag
cataactttgccatggttgtccatacaaaagcagcaggcaggaccagtatcaaggtcact
gttcactgcatgaacagttcctctgggcagtttgaggggaatttgttggaactctctgat
gaagtacagatcctggtgtttgaaaaactccaactcttctatccagagtgccaaccagag
cagattctgatgcctataaattctcagctcaaactccataccaacagggaaggagctgcc
ttcgtgagttctcgtgttctcaagtgtttccctaattcatccgtcattgaggaggatggt
gaagggctcctgaaagctggttccattgcaggtactgctgtattggaagtcacttctata
gaaccttttggagtcaaccaaacaaccataactggggtccaggtagcaccggtgacatac
ctgcgagtgagcagccaacccaagctatacacagcccaaggaaggaccctgtcagcattt
cccttgggcatgtctcttaccttcactgttcagttttataatagtatcggagagaaattc
cacacacacaatacccagctttatctggctctgaacagagatgacttgctgcatattgga
ccagggaataagaactatacttacatggcccaggctgtgaacagagggctgacacttgtg
gggctttgggaccggagacatccaggcatggcagattatattcctgttgctgtagagcat
gccattgagccagacaccaagcttacctttgttggagatatcatctgcttcagtactcac
cttgtcagccagcatggtgaacctgggatatggatgatttctgccaacaatattctacag
acagacattgtcactggagtaggagtggccaggagtccggggactgcaatgatttttcat
gacatcccaggagtagtgaaaacatatcgagaggtggtggtcaatgcatcatcaagatta
atgctcagttatgacctcaagacttatctcaccaataccctcaattcaactgtattcaag
ctcttcatcaccactggcagaaatggtgtcaatcttaaaggattctgtaccccaaaccag
gccttggccattacaaaagtacttcttccagcgaccctcatgctgtgccatgtacagttc
agtaatactttgctagacattccagcaagtaaagtctttcaggtccattcagatttcagt
atggagaaaggggtttatgtctgcataatcaaggttcgaccgcagtcagaggagctgcta
caggccctcagtgtggctgacacctcagtctatgggtgggctacactggtcagtgaacgt
agcaagaatggaatgcaacgaatcctcattcctttcatcccagccttttatattaaccag
tcagaattggttcttagccacaaacaagatatcggggagataagagtactgggagtggac
agagttcttaggaagctagaggtcatctccagctccccagttctagtggtcgctggccat
agccactctcccctcactcctggcctggccatttactctgtaagagtggtcaacttcact
tccttccagcaaatggcatcacctgttttcatcaatatttcctgtgtactcaccagtcaa
agtgaggcagtggtagtgagggctatgaaagataagttgggtgcagatcactgtgaagat
tccgccatcctcaagcggttcactggctcttaccagatcctgctcttgaccctctttgca
gtgctggcatcaacagcttccatcttcctagcatacaatgccttcctaaacaagatacaa
acagttccagttgtgtatgtaccaactctaggaacaccacagccaggtttttttaactcc
acaagttctccccctcacttcatgagtctacaacctccattggcccaaagtcggctgcaa
cattggttatggagtataaggcactaa

DBGET integrated database retrieval system