KEGG   Homo sapiens (human): 91181Help
Entry
91181             CDS       T01001                                 

Gene name
NUP210L, RP11-144B19.1
Definition
nucleoporin 210kDa-like
Orthology
K14314  
nuclear pore complex protein Nup210
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21.3
AA seq 1736 aa AA seqDB search
MTGCPASSRRRGFGLFFFLRLHRLLLLFLVLRGTLANKLNVPQVLLPFGREPGRVPFLLE
AQRGCYTWHSTHHDAVTVEPLYENGTLCSQKAVLIAESTQPIRLSSIILAREIVTDHELR
CDVKVDVINSIEIVSRARELYVDDSPLELMVRALDAEGNTFSSLAGMMFEWSIAQDNESA
REELSSKIRILKYSEAEYAPPIYIAEMEKEEKQGDVILVSGIRTGAAVVKVRIHEPFYKK
VAAALIRLLVLENIFLIPSHDIYLLVGTYIKYQVAKMVQGRVTEVKFPLEHYILELQDHR
VALNGSHSEKVAILDDKTAMVTASQLGQTNLVFVHKNVHMRSVSGLPNCTIYVVEPGFLG
FTVQPGNRWSLEVGQVYVITVDVFDKSSTKVYISDNLRITYDFPKEYFEEQLTTVNGSYH
IVKALKDGVVVINASLTSIIYQNKDIQPIKFLIKHQQEVKIYFPIMLTPKFLAFPHHPMG
MLYRYKVQVEGGSGNFTWTSSNETVVIVTTKGVVTAGQVRGNSTVLARDVQNPFRYGEIK
IHVLKLNKMELLPFHADVEIGQIIEIPIAMYHINKETKEAMAFTDCSHLSLDLNMDKQGV
FTLLKEGIQRPGPMHCSSTHIAAKSLGHTLVTVSVNECDKYLESSATFAAYEPLKALNPV
EVALVTWQSVKEMVFEGGPRPWILEPSRFFLELNAEKTEKIGIAQVWLPSKRKQNQYIYR
IQCLDLGEQVLTFRIGNHPGVLNPSPAVEVLQVRFICAHPASMSVTPVYKVPAGAQPCPL
PQHNKWLIPVSRLRDTVLELAVFDQHRRKFDNFSSLMLEWKSSNETLAHFEDYKSVEMVA
KDDGSGQTRLHGHQILKVHQIKGTVLIGVNFVGYSEKKSPKEISNLPRSVDVELLLVDDV
TVVPENATIYNHPDVKETFSLVEGSGYFLVNSSEQGVVTITYMEAESSVELVPLHPGFFT
LEVYDLCLAFLGPATAHLRVSDIQELELDLIDKVEIDKTVLVTVRVLGSSKRPFQNKYFR
NMELKLQLASAIVTLTPMEQQDEYSENYILRATTIGQTTLVAIAKDKMGRKYTSTPRHIE
VFPPFRLLPEKMTLIPMNMMQVMSEGGPQPQSIVHFSISNQTVAVVNRRGQVTGKIVGTA
VVHGTIQTVNEDTGKVIVFSQDEVQIEVVQLRAVRILAAATRLITATKMPVYVMGVTSTQ
TPFSFSNANPGLTFHWSMSKRDVLDLVPRHSEVFLQLPVEHNFAMVVHTKAAGRTSIKVT
VHCMNSSSGQFEGNLLELSDEVQILVFEKLQLFYPECQPEQILMPINSQLKLHTNREGAA
FVSSRVLKCFPNSSVIEEDGEGLLKAGSIAGTAVLEVTSIEPFGVNQTTITGVQVAPVTY
LRVSSQPKLYTAQGRTLSAFPLGMSLTFTVQFYNSIGEKFHTHNTQLYLALNRDDLLHIG
PGNKNYTYMAQAVNRGLTLVGLWDRRHPGMADYIPVAVEHAIEPDTKLTFVGDIICFSTH
LVSQHGEPGIWMISANNILQTDIVTGVGVARSPGTAMIFHDIPGVVKTYREVVVNASSRL
MLSYDLKTYLTNTLNSTVFKLFITTGRNGVNLKGFCTPNQALAITKVLLPATLMLCHVQF
SNTLLDIPASKVFQVHSDFSMEKDHCEDSAILKRFTGSYQILLLTLFAVLASTASIFLAY
NAFLNKIQTVPVVYVPTLGTPQPGFFNSTSSPPHFMSLQPPLAQSRLQHWLWSIRH
NT seq 5211 nt NT seq  +upstreamnt  +downstreamnt
atgactggctgtccggcgtcatcaagacgccgaggcttcgggctctttttcttcttgcgt
ctacaccgcctcctgttgttgtttctggttttgcgtgggaccctggccaacaaacttaac
gtgccacaggtgttgctacccttcggccgagagccaggccgggtgcctttcctgctggag
gcccagcggggctgctacacttggcattccacccatcatgatgcagttactgttgagcct
ttatatgaaaatggcaccttgtgttcccaaaaagctgtactcattgctgaatctacgcaa
ccgatacgcctcagcagtattattcttgctcgagaaatagtgactgaccatgagctacgc
tgtgatgttaaggttgatgtgataaacagcattgaaattgtatctcgggcccgggaactt
tatgtagatgattcgccactggaactgatggtgagggcattggatgctgaaggaaatact
tttagtagtttggcagggatgatgtttgagtggagcattgcccaggacaacgagtcagca
agagaagaactgtctagcaaaattaggattcttaaatactccgaagcagaatatgctccc
ccaatatatatagctgagatggaaaaagaggagaaacaaggagatgtgattttagtgtct
gggattagaactggtgctgctgttgtaaaagttcgaattcatgaaccattctataagaaa
gtggcagcagccttaatacgtctgcttgttttggagaatatatttcttataccatcccat
gatatttatctcttagtaggaacatatattaaataccaagttgcaaaaatggttcaaggg
agagtgacagaggtgaaatttcccctggaacattatatactggaattgcaagaccataga
gttgcacttaacgggtctcattctgagaaagtggctatactggatgacaaaacagccatg
gtgactgcctcacaactgggccagactaatcttgtctttgtccataaaaatgttcatatg
cgatctgtgtctggactcccaaattgcaccatatatgttgtagagcctggatttttaggt
ttcactgtccaacctggaaaccgatggagtctagaggtgggacaggtatatgtcattaca
gtagacgtctttgataaaagcagcacaaaggtctatatttcagataatctcaggattaca
tacgactttcctaaggagtactttgaagagcaactaactaccgtgaatggatcttaccat
atagtaaaagccctgaaagatggtgttgtggtaataaatgcatccctgacctccatcatt
taccagaataaagatattcagcctataaaatttctaatcaaacaccaacaagaagtgaag
atttattttcccatcatgcttacacccaaatttctggcatttcctcatcatcctatggga
atgttatatcgttataaagtacaggtagagggtggcagtggcaactttacctggacttct
tctaatgaaacagtggtcatagtaaccacgaaaggagtggtgactgcaggtcaggtcagg
gggaatagtactgttttggcccgagatgtacaaaatccctttcgatatggagaaattaag
atacatgtcctgaaactgaacaaaatggaactgttaccatttcatgctgatgtggagatt
ggccagattatagaaatacccattgcaatgtatcacataaataaagagaccaaagaagcc
atggcattcacagactgctctcatttatccttggatctgaacatggataaacaaggagtc
tttactcttctcaaagaaggtattcaaagacctggaccaatgcattgttccagtacacat
atcgcagctaaatctcttggccatactctggtaacagtaagtgtgaatgaatgtgacaag
tacttggagagcagtgctacatttgctgcttatgaacccctaaaggctttaaatcctgtg
gaagtggcattggtgacatggcagtctgtgaaggaaatggtatttgaagggggtcctcgt
ccatggatcttggagccctcccgattttttttggaattgaatgcggagaagacagagaag
attggaatagcacaagtgtggctgccatctaagagaaaacagaaccagtacatctaccgg
atccaatgcctggatttaggggaacaagttctcacattccgaattggaaatcatccaggt
gtcctgaaccctagtccagctgtagaggttttgcaggttcgcttcatttgtgcccaccct
gccagtatgtcagtaactccagtatacaaggtgccagctggtgcccagccatgtcctctg
ccacagcacaacaaatggctgattcctgtatcaagactgagggacacagtcctggaacta
gcagtgtttgatcaacataggagaaagtttgataatttcagttcactaatgctagaatgg
aaatcctccaatgaaacactagcccatttcgaagattataaatcagtggaaatggtagca
aaagatgatggcagtgggcagacccggttacatggtcatcagatccttaaagtacatcag
ataaaagggactgtactgattggagtcaattttgtgggctattcagagaagaaaagccca
aaagaaatttccaacttgcccagatctgtagatgtggaactgctcctggtagatgatgta
actgtagtgcctgagaatgccaccatctataaccaccctgatgtaaaggaaacatttagc
cttgtggaaggatctggttattttttagtcaacagcagtgagcagggtgttgtcaccatc
acttacatggaagcagaaagctctgttgagttagttccattacatcctggattttttacc
ttggaggtctatgatctttgtttggctttcttgggtccagcaacagcccacctcagggtg
tcagacatacaagagctggagcttgatctgattgataaggttgaaatagacaaaactgtg
ttagtgactgtgagggttcttggctcttccaaacgcccattccaaaataaatacttcaga
aacatggaactcaaactgcagttggcttctgccattgtcaccctgacaccaatggagcaa
caggacgaatactctgaaaattatattcttcgagctaccactattgggcaaaccacactt
gtggctattgccaaggacaagatgggaagaaaatacacatcaactcctcggcacattgaa
gtgtttcctccattcagacttcttccagagaaaatgacactgattccaatgaatatgatg
caggtaatgtctgaaggtggcccccagccccaatccatcgttcacttctccatcagtaat
cagaccgtggctgttgttaataggagggggcaagttacagggaagattgttggcacagct
gtggttcatggcaccatccagacagtaaatgaagatactggcaaagtcattgtgttttct
caggatgaagtacagattgaagttgttcagctaagggctgttaggatccttgcagctgca
actcggctcatcacagctaccaagatgccagtttatgtcatgggagtaaccagtacccag
acccctttctccttcagcaatgctaatcctgggctcacattccactggtctatgagcaaa
agggatgtattggatctagtgcccaggcattcagaggtttttctacagctcccagtagag
cataactttgccatggttgtccatacaaaagcagcaggcaggaccagtatcaaggtcact
gttcactgcatgaacagttcctctgggcagtttgaggggaatttgttggaactctctgat
gaagtacagatcctggtgtttgaaaaactccaactcttctatccagagtgccaaccagag
cagattctgatgcctataaattctcagctcaaactccataccaacagggaaggagctgcc
ttcgtgagttctcgtgttctcaagtgtttccctaattcatccgtcattgaggaggatggt
gaagggctcctgaaagctggttccattgcaggtactgctgtattggaagtcacttctata
gaaccttttggagtcaaccaaacaaccataactggggtccaggtagcaccggtgacatac
ctgcgagtgagcagccaacccaagctatacacagcccaaggaaggaccctgtcagcattt
cccttgggcatgtctcttaccttcactgttcagttttataatagtatcggagagaaattc
cacacacacaatacccagctttatctggctctgaacagagatgacttgctgcatattgga
ccagggaataagaactatacttacatggcccaggctgtgaacagagggctgacacttgtg
gggctttgggaccggagacatccaggcatggcagattatattcctgttgctgtagagcat
gccattgagccagacaccaagcttacctttgttggagatatcatctgcttcagtactcac
cttgtcagccagcatggtgaacctgggatatggatgatttctgccaacaatattctacag
acagacattgtcactggagtaggagtggccaggagtccggggactgcaatgatttttcat
gacatcccaggagtagtgaaaacatatcgagaggtggtggtcaatgcatcatcaagatta
atgctcagttatgacctcaagacttatctcaccaataccctcaattcaactgtattcaag
ctcttcatcaccactggcagaaatggtgtcaatcttaaaggattctgtaccccaaaccag
gccttggccattacaaaagtacttcttccagcgaccctcatgctgtgccatgtacagttc
agtaatactttgctagacattccagcaagtaaagtctttcaggtccattcagatttcagt
atggagaaagatcactgtgaagattccgccatcctcaagcggttcactggctcttaccag
atcctgctcttgaccctctttgcagtgctggcatcaacagcttccatcttcctagcatac
aatgccttcctaaacaagatacaaacagttccagttgtgtatgtaccaactctaggaaca
ccacagccaggtttttttaactccacaagttctccccctcacttcatgagtctacaacct
ccattggcccaaagtcggctgcaacattggttatggagtataaggcactaa

DBGET integrated database retrieval system