KEGG   Homo sapiens (human): 9126Help
Entry
9126              CDS       T01001                                 

Gene name
SMC3, BAM, BMH, CDLS3, CSPG6, HCAP, SMC3L1
Definition
structural maintenance of chromosomes 3
Orthology
K06669  
structural maintenance of chromosome 3 (chondroitin sulfate proteoglycan 6)
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Disease
H00631  
Cornelia de Lange syndrome (CdLS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    9126 (SMC3)
   04114 Oocyte meiosis
    9126 (SMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q25
AA seq 1217 aa AA seqDB search
MYIKQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQ
RLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKND
VMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMK
ETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLD
ELSAKRETSGEKSRQLRDAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQEQIK
QRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFNSVKEKEER
GIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDL
EDTEANKEKNLEQYNKLDQDLNEVKARVEELDRKYYEVKNKKDELQSERNYLWREENAEQ
QALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLDHFRRKGINQHVQNGYHGIVMNNF
ECEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAY
PETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSH
RGALTGGYYDTRKSRLELQKDVRKAEEELGELEAKLNENLRRNIERINNEIDQLMNQMQQ
IETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAE
LGTDLLSQLSLEDQKRVDALNDEIRQLQQENRQLLNERIKLEGIITRVETYLNENLRKRL
DQVEQELNELRETEGGTVLTATTSELEAINKRVKDTMARSEDLDNSIDKTEAGIKELQKS
MERWKNMEKEHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTL
SLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNV
LELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERG
SGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFY
LFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDV
ITAEMAKDFVEDDTTHG
NT seq 3654 nt NT seq  +upstreamnt  +downstreamnt
atgtacataaagcaggtgattatccagggttttcgaagttacagagatcaaacaattgta
gatcccttcagttcaaaacataatgtgattgtgggcagaaatggatctggaaaaagtaac
tttttttatgcaattcagtttgttctcagtgatgagtttagtcatcttcgtccagaacag
cggttggctttattgcatgaaggtactggtcctcgtgttatttctgcttttgtggagatt
atttttgataattcagacaaccggttaccaatcgataaagaggaagtttcacttcgaaga
gttattggtgccaaaaaggatcagtatttcttagacaagaagatggtcacgaaaaatgat
gtgatgaacctccttgaaagcgctggtttttctcgaagcaatccttattatattgttaaa
caaggaaagatcaaccagatggcaacagcaccagattctcagagattaaagctattaaga
gaagtagctggtactagagtgtatgacgaacgaaaggaagaaagcatctccttaatgaaa
gaaacagagggcaaacgggaaaaaatcaatgagttgttaaaatacattgaagagagatta
catactctagaggaagaaaaggaagaactagctcagtatcagaagtgggataaaatgaga
cgagccctggaatataccatttacaatcaggaacttaacgagactcgtgccaaacttgat
gagctttctgctaagcgagagactagtggagaaaaatccagacaattaagagatgctcag
caggatgcaagagataaaatggaggatatcgaacgccaagttagagaattgaaaacaaaa
atttcagctatgaaagaagaaaaagaacagcttagtgctgaaagacaagagcagattaag
cagaggactaagttggagcttaaagccaaggatttacaagatgaactagcaggcaatagt
gaacaaaggaaacgtttattaaaagagaggcagaagctgcttgaaaaaatagaagaaaag
cagaaagaactggcagaaacagaacccaaattcaacagtgtgaaagagaaagaagaacga
ggaattgctagattggctcaagctacccaggaaagaacggatctttatgcaaagcagggt
cgaggaagccagtttacatcaaaagaagaaagggataagtggattaaaaaggaactcaag
tctttagatcaggctattaatgacaagaaaagacagattgctgctatacataaggatttg
gaagacactgaagcaaataaagagaaaaatctggagcagtataataaactggaccaggat
cttaatgaagtcaaagctcgagtagaagaactggacagaaaatattacgaagtaaaaaat
aagaaagatgaactacaaagtgaaagaaactacttgtggagagaagagaatgcagaacag
caagcacttgctgctaaaagagaagatcttgaaaagaagcaacaacttcttagagcagca
acaggaaaggccattttaaatggaatagacagcataaacaaagtgctagaccacttccgt
cgaaaaggaataaaccagcatgttcaaaatggctatcatggtattgtaatgaataacttt
gaatgtgaaccagctttctacacatgcgtggaagtcactgctggaaacaggttattttat
cacattgttgattcagatgaagtcagcacgaagattttaatggagtttaataaaatgaat
cttcctggagaggttacttttctgcctcttaacaagttagatgtcagggatacagcctat
cctgaaaccaatgatgctattcctatgatcagcaaactgaggtacaatcccagatttgac
aaagctttcaaacatgtgtttggaaagactcttatttgtcgtagcatggaagtttcaacc
cagctggcccgtgctttcactatggactgtattactttggaaggtgaccaagtcagccat
cggggtgctctaactgggggttattatgacacaaggaagtctcgacttgaattgcaaaaa
gatgttagaaaagcagaagaagaactaggtgaacttgaagcaaagctcaatgaaaacctg
cgcagaaatattgaaaggattaataatgaaattgatcagttgatgaaccaaatgcaacag
atcgagacccagcaaaggaaatttaaagcatctagagatagcatattatcagaaatgaag
atgctaaaagagaagaggcagcagtcagagaaaaccttcatgcctaagcaacgtagctta
cagagtttggaggcaagcttgcatgctatggagtctaccagagagtcattgaaagcagaa
ctgggaactgatttgctttctcaactgagtttggaagatcagaagagagtagatgcactg
aatgatgagattcgtcaacttcagcaggaaaacagacagttgctaaatgaaagaattaaa
ttagaaggtattattactcgagtagagacttatctcaatgagaatctgagaaaacgcttg
gaccaagtagaacaggaacttaatgagctgagagagacagaagggggtactgttctcaca
gccacaacatcagaacttgaagccatcaataaaagagtaaaagacactatggcacgatca
gaagatttggacaattccattgataaaacagaagctggaattaaggagcttcagaagagt
atggagcgctggaaaaatatggaaaaagaacatatggatgctataaatcatgatactaaa
gaactggaaaagatgacaaatcggcaaggcatgctattgaagaagaaagaagagtgtatg
aagaaaattcgagaacttggatcacttccccaggaagcatttgaaaagtaccagacactg
agcctcaaacagttgtttcgaaaacttgagcagtgcaacacagaattaaagaagtacagc
catgttaacaaaaaggctttggatcagtttgtaaatttctccgagcagaaagaaaagtta
ataaagcgtcaagaagagttagataggggttacaaatcaatcatggaactgatgaatgta
cttgaacttcggaaatatgaagctattcagttaactttcaaacaggtatctaagaacttc
agtgaagtattccagaagttagtacctggtggcaaagctactttggtgatgaagaaagga
gatgtggagggcagtcagtctcaagatgaaggagaagggagtggtgagagtgagaggggt
tctggctcacaaagcagtgtcccatcagttgaccagtttactggagttggaattagggtg
tcatttacaggaaaacaaggtgaaatgagagaaatgcaacagctttcaggtggacagaaa
tccttggtagcccttgctctgatttttgccattcagaaatgtgacccggctccattttac
ttgtttgatgaaattgaccaggctctggatgctcagcacagaaaggctgtgtcagatatg
attatggaacttgctgtacatgctcagtttattacaactacttttaggcctgaactgctt
gagtcagctgacaaattctatggtgtaaagttcagaaataaggttagtcatattgatgtg
atcacagcagagatggccaaagactttgtagaagatgataccacacatggttaa

DBGET integrated database retrieval system