KEGG   Homo sapiens (human): 9134Help
Entry
9134              CDS       T01001                                 

Gene name
CCNE2, CYCE2
Definition
(RefSeq) cyclin E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04115  p53 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04934  Cushing's syndrome
hsa05161  Hepatitis B
hsa05162  Measles
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05215  Prostate cancer
hsa05222  Small cell lung cancer
hsa05226  Gastric cancer
Module
hsa_M00692  Cell cycle - G1/S transition
Network
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00093  Loss of CDKN1B to p27-cell cycle G1/S
N00267  HBV HBx to host-cell-protein activation
N00316  Mutation-inactivated CDKN1B to p27-cell cycle G1/S
Disease
H00055  Laryngeal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    9134 (CCNE2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    9134 (CCNE2)
   04114 Oocyte meiosis
    9134 (CCNE2)
   04115 p53 signaling pathway
    9134 (CCNE2)
   04218 Cellular senescence
    9134 (CCNE2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    9134 (CCNE2)
   05206 MicroRNAs in cancer
    9134 (CCNE2)
   05203 Viral carcinogenesis
    9134 (CCNE2)
   05226 Gastric cancer
    9134 (CCNE2)
   05215 Prostate cancer
    9134 (CCNE2)
   05222 Small cell lung cancer
    9134 (CCNE2)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    9134 (CCNE2)
  Infectious diseases
   05162 Measles
    9134 (CCNE2)
   05161 Hepatitis B
    9134 (CCNE2)
   05165 Human papillomavirus infection
    9134 (CCNE2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    9134 (CCNE2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    9134 (CCNE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 9134
NCBI-ProteinID: NP_477097
OMIM: 603775
HGNC: 1590
Ensembl: ENSG00000175305
Vega: OTTHUMG00000164696
Pharos: O96020(Tbio)
UniProt: O96020 A0A024R9B0
Position
8q22.1
AA seq 404 aa AA seqDB search
MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKK
ESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCP
VTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAA
LCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTH
TNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagacgaagtagccgtttacaagctaagcagcagccccagcccagccagacggaa
tccccccaagaagcccagataatccaggccaagaagaggaaaactacccaggatgtcaaa
aaaagaagagaggaggtcaccaagaaacatcagtatgaaattaggaattgttggccacct
gtattatctggggggatcagtccttgcattatcattgaaacacctcacaaagaaatagga
acaagtgatttctccagatttacaaattacagatttaaaaatctttttattaatccttca
cctttgcctgatttaagctggggatgttcaaaagaagtctggctaaacatgttaaaaaag
gagagcagatatgttcatgacaaacattttgaagttctgcattctgacttggaaccacag
atgaggtccatacttctagactggcttttagaggtatgtgaagtatacacacttcatagg
gaaacattttatcttgcacaagacttttttgatagatttatgttgacacaaaaggatata
aataaaaatatgcttcaactcattggaattacctcattattcattgcttccaaacttgag
gaaatctatgctcctaaactccaagagtttgcttacgtcactgatggtgcttgcagtgaa
gaggatatcttaaggatggaactcattatattaaaggctttaaaatgggaactttgtcct
gtaacaatcatctcctggctaaatctctttctccaagttgatgctcttaaagatgctcct
aaagttcttctacctcagtattctcaggaaacattcattcaaatagctcagcttttagat
ctgtgtattctagccattgattcattagagttccagtacagaatactgactgctgctgcc
ttgtgccattttacctccattgaagtggttaagaaagcctcaggtttggagtgggacagt
atttcagaatgtgtagattggatggtaccttttgtcaatgtagtaaaaagtactagtcca
gtgaagctgaagacttttaagaagattcctatggaagacagacataatatccagacacat
acaaactatttggctatgctggaggaagtaaattacataaacaccttcagaaaaggggga
cagttgtcaccagtgtgcaatggaggcattatgacaccaccgaagagcactgaaaaacca
ccaggaaaacactaa

DBGET integrated database retrieval system