KEGG   Homo sapiens (human): 9140Help
Entry
9140              CDS       T01001                                 

Gene name
ATG12, APG12, APG12L, FBR93, HAPG12
Definition
(RefSeq) autophagy related 12
  KO
K08336  ubiquitin-like protein ATG12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    9140 (ATG12)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    9140 (ATG12)
   04136 Autophagy - other eukaryotes
    9140 (ATG12)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    9140 (ATG12)
   04622 RIG-I-like receptor signaling pathway
    9140 (ATG12)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    9140 (ATG12)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   9140 (ATG12)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    9140 (ATG12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APG12 Atg8
Motif
Other DBs
NCBI-GeneID: 9140
NCBI-ProteinID: NP_004698
OMIM: 609608
HGNC: 588
Ensembl: ENSG00000145782
Vega: OTTHUMG00000128889
Pharos: O94817(Tbio)
UniProt: O94817
Structure
PDB: 

Jmol
Position
5q22.3
AA seq 140 aa AA seqDB search
MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLK
AVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLY
ECFGSDGKLVLHYCKSQAWG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggagccgcagtctgtgttgcagcttcctacttcaattgctgctggaggggaa
ggacttacggatgtctccccagaaacaaccaccccggagcccccgtcttccgctgcagtt
tccccgggaacagaggaacctgctggcgacaccaagaaaaaaattgacattttgctaaag
gctgtgggagacactcctattatgaaaacaaagaagtgggcagtagagcgaacacgaacc
atccaaggactcattgacttcatcaaaaagtttcttaaacttgtggcctcagaacagttg
tttatttatgtgaatcagtcctttgctccttccccagaccaagaagttggaactctctat
gagtgttttggcagtgatggtaaactggttttacattactgcaagtctcaggcgtgggga
tga

DBGET integrated database retrieval system