KEGG   Homo sapiens (human): 9140Help
Entry
9140              CDS       T01001                                 

Gene name
ATG12, APG12, APG12L, FBR93, HAPG12
Definition
autophagy related 12
Orthology
K08336  
ubiquitin-like protein ATG12
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Regulation of autophagy
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    9140 (ATG12)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    9140 (ATG12)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    9140 (ATG12)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    9140 (ATG12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q21-q22
AA seq 74 aa AA seqDB search
MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIYLCES
VLCSFPRPRSWNSL
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggagccgcagtctgtgttgcagcttcctacttcaattgctgctggaggggaa
ggacttacggatgtctccccagaaacaaccaccccggagcccccgtcttccgctgcagtt
tccccgggaacagaggaacctgctggcgacaccaagaaaaaaatttatttatgtgaatca
gtcctttgctccttccccagaccaagaagttggaactctctatga

DBGET integrated database retrieval system