KEGG   Homo sapiens (human): 91543Help
Entry
91543             CDS       T01001                                 

Gene name
RSAD2, 2510004L01Rik, cig33, cig5, vig1
Definition
(RefSeq) radical S-adenosyl methionine domain containing 2
  KO
K15045  radical S-adenosyl methionine domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05164 Influenza A
    91543 (RSAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM Fer4_12 Fer4_14 DUF4018
Motif
Other DBs
NCBI-GeneID: 91543
NCBI-ProteinID: NP_542388
OMIM: 607810
HGNC: 30908
Ensembl: ENSG00000134321
Vega: OTTHUMG00000090352
Pharos: Q8WXG1(Tbio)
UniProt: Q8WXG1
Position
2p25.2
AA seq 361 aa AA seqDB search
MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETK
EEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKI
NFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISC
DSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKAL
NPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDS
YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLD
W
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtgcttacacctgctgcttttgctgggaagctcttgagtgtgttcaggcaacct
ctgagctctctgtggaggagcctggtcccgctgttctgctggctgagggcaaccttctgg
ctgctagctaccaagaggagaaagcagcagctggtcctgagagggccagatgagaccaaa
gaggaggaagaggaccctcctctgcccaccaccccaaccagcgtcaactatcacttcact
cgccagtgcaactacaaatgcggcttctgtttccacacagccaaaacatcctttgtgctg
ccccttgaggaagcaaagagaggattgcttttgcttaaggaagctggtatggagaagatc
aacttttcaggtggagagccatttcttcaagaccggggagaatacctgggcaagttggtg
aggttctgcaaagtagagttgcggctgcccagcgtgagcatcgtgagcaatggaagcctg
atccgggagaggtggttccagaattatggtgagtatttggacattctcgctatctcctgt
gacagctttgacgaggaagtcaatgtccttattggccgtggccaaggaaagaagaaccat
gtggaaaaccttcaaaagctgaggaggtggtgtagggattatagagtcgctttcaagata
aattctgtcattaatcgtttcaacgtggaagaggacatgacggaacagatcaaagcacta
aaccctgtccgctggaaagtgttccagtgcctcttaattgagggtgagaattgtggagaa
gatgctctaagagaagcagaaagatttgttattggtgatgaagaatttgaaagattcttg
gagcgccacaaagaagtgtcctgcttggtgcctgaatctaaccagaagatgaaagactcc
taccttattctggatgaatatatgcgctttctgaactgtagaaagggacggaaggaccct
tccaagtccatcctggatgttggtgtagaagaagctataaaattcagtggatttgatgaa
aagatgtttctgaagcgaggaggaaaatacatatggagtaaggctgatctgaagctggat
tggtag

DBGET integrated database retrieval system