KEGG   Homo sapiens (human): 91543Help
Entry
91543             CDS       T01001                                 

Gene name
RSAD2, 2510004L01Rik, cig33, cig5, vig1
Definition
radical S-adenosyl methionine domain containing 2
Orthology
K15045  
radical S-adenosyl methionine domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Influenza A
Class
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p25.2
AA seq 361 aa AA seqDB search
MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETK
EEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKI
NFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISC
DSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKAL
NPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDS
YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLD
W
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtgcttacacctgctgcttttgctgggaagctcttgagtgtgttcaggcaacct
ctgagctctctgtggaggagcctggtcccgctgttctgctggctgagggcaaccttctgg
ctgctagctaccaagaggagaaagcagcagctggtcctgagagggccagatgagaccaaa
gaggaggaagaggaccctcctctgcccaccaccccaaccagcgtcaactatcacttcact
cgccagtgcaactacaaatgcggcttctgtttccacacagccaaaacatcctttgtgctg
ccccttgaggaagcaaagagaggattgcttttgcttaaggaagctggtatggagaagatc
aacttttcaggtggagagccatttcttcaagaccggggagaatacctgggcaagttggtg
aggttctgcaaagtagagttgcggctgcccagcgtgagcatcgtgagcaatggaagcctg
atccgggagaggtggttccagaattatggtgagtatttggacattctcgctatctcctgt
gacagctttgacgaggaagtcaatgtccttattggccgtggccaaggaaagaagaaccat
gtggaaaaccttcaaaagctgaggaggtggtgtagggattatagagtcgctttcaagata
aattctgtcattaatcgtttcaacgtggaagaggacatgacggaacagatcaaagcacta
aaccctgtccgctggaaagtgttccagtgcctcttaattgagggtgagaattgtggagaa
gatgctctaagagaagcagaaagatttgttattggtgatgaagaatttgaaagattcttg
gagcgccacaaagaagtgtcctgcttggtgcctgaatctaaccagaagatgaaagactcc
taccttattctggatgaatatatgcgctttctgaactgtagaaagggacggaaggaccct
tccaagtccatcctggatgttggtgtagaagaagctataaaattcagtggatttgatgaa
aagatgtttctgaagcgaggaggaaaatacatatggagtaaggctgatctgaagctggat
tggtag

DBGET integrated database retrieval system