KEGG   Homo sapiens (human): 9156Help
Entry
9156              CDS       T01001                                 

Gene name
EXO1, HEX1, hExoI
Definition
(RefSeq) exonuclease 1
  KO
K10746  
exonuclease 1 [EC:3.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Mismatch repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    9156 (EXO1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     9156 (EXO1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    9156 (EXO1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Other MMR factors
     9156 (EXO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9UQ84(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1q43
AA seq 846 aa AA seqDB search
MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCM
KFVNMLLSHGIKPILVFDGCTLPSKKEVERSRRERRQANLLKGKQLLREGKVSEARECFT
RSINITHAMAHKVIKAARSQGVDCLVAPYEADAQLAYLNKAGIVQAIITEDSDLLAFGCK
KVILKMDQFGNGLEIDQARLGMCRQLGDVFTEEKFRYMCILSGCDYLSSLRGIGLAKACK
VLRLANNPDIVKVIKKIGHYLKMNITVPEDYINGFIRANNTFLYQLVFDPIKRKLIPLNA
YEDDVDPETLSYAGQYVDDSIALQIALGNKDINTFEQIDDYNPDTAMPAHSRSHSWDDKT
CQKSANVSSIWHRNYSPRPESGTVSDAPQLKENPSTVGVERVISTKGLNLPRKSSIVKRP
RSAELSEDDLLSQYSLSFTKKTKKNSSEGNKSLSFSEVFVPDLVNGPTNKKSVSTPPRTR
NKFATFLQRKNEESGAVVVPGTRSRFFCSSDSTDCVSNKVSIQPLDETAVTDKENNLHES
EYGDQEGKRLVDTDVARNSSDDIPNNHIPGDHIPDKATVFTDEESYSFESSKFTRTISPP
TLGTLRSCFSWSGGLGDFSRTPSPSPSTALQQFRRKSDSPTSLPENNMSDVSQLKSEESS
DDESHPLREEACSSQSQESGEFSLQSSNASKLSQCSSKDSDSEESDCNIKLLDSQSDQTS
KLRLSHFSKKDTPLRNKVPGLYKSSSADSLSTTKIKPLGPARASGLSKKPASIQKRKHHN
AENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRV
QRAIFQ
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atggggatacagggattgctacaatttatcaaagaagcttcagaacccatccatgtgagg
aagtataaagggcaggtagtagctgtggatacatattgctggcttcacaaaggagctatt
gcttgtgctgaaaaactagccaaaggtgaacctactgataggtatgtaggattttgtatg
aaatttgtaaatatgttactatctcatgggatcaagcctattctcgtatttgatggatgt
actttaccttctaaaaaggaagtagagagatctagaagagaaagacgacaagccaatctt
cttaagggaaagcaacttcttcgtgaggggaaagtctcggaagctcgagagtgtttcacc
cggtctatcaatatcacacatgccatggcccacaaagtaattaaagctgcccggtctcag
ggggtagattgcctcgtggctccctatgaagctgatgcgcagttggcctatcttaacaaa
gcgggaattgtgcaagccataattacagaggactcggatctcctagcttttggctgtaaa
aaggtaattttaaagatggaccagtttggaaatggacttgaaattgatcaagctcggcta
ggaatgtgcagacagcttggggatgtattcacggaagagaagtttcgttacatgtgtatt
ctttcaggttgtgactacctgtcatcactgcgtgggattggattagcaaaggcatgcaaa
gtcctaagactagccaataatccagatatagtaaaggttatcaagaaaattggacattat
ctcaagatgaatatcacggtaccagaggattacatcaacgggtttattcgggccaacaat
accttcctctatcagctagtttttgatcccatcaaaaggaaacttattcctctgaacgcc
tatgaagatgatgttgatcctgaaacactaagctacgctgggcaatatgttgatgattcc
atagctcttcaaatagcacttggaaataaagatataaatacttttgaacagatcgatgac
tacaatccagacactgctatgcctgcccattcaagaagtcatagttgggatgacaaaaca
tgtcaaaagtcagctaatgttagcagcatttggcataggaattactctcccagaccagag
tcgggtactgtttcagatgccccacaattgaaggaaaatccaagtactgtgggagtggaa
cgagtgattagtactaaagggttaaatctcccaaggaaatcatccattgtgaaaagacca
agaagtgcagagctgtcagaagatgacctgttgagtcagtattctctttcatttacgaag
aagaccaagaaaaatagctctgaaggcaataaatcattgagcttttctgaagtgtttgtg
cctgacctggtaaatggacctactaacaaaaagagtgtaagcactccacctaggacgaga
aataaatttgcaacatttttacaaaggaaaaatgaagaaagtggtgcagttgtggttcca
gggaccagaagcaggtttttttgcagttcagattctactgactgtgtatcaaacaaagtg
agcatccagcctctggatgaaactgctgtcacagataaagagaacaatctgcatgaatca
gagtatggagaccaagaaggcaagagactggttgacacagatgtagcacgtaattcaagt
gatgacattccgaataatcatattccaggtgatcatattccagacaaggcaacagtgttt
acagatgaagagtcctactcttttgagagcagcaaatttacaaggaccatttcaccaccc
actttgggaacactaagaagttgttttagttggtctggaggtcttggagatttttcaaga
acgccgagcccctctccaagcacagcattgcagcagttccgaagaaagagcgattccccc
acctctttgcctgagaataatatgtctgatgtgtcgcagttaaagagcgaggagtccagt
gacgatgagtctcatcccttacgagaagaggcatgttcttcacagtcccaggaaagtgga
gaattctcactgcagagttcaaatgcatcaaagctttctcagtgctctagtaaggactct
gattcagaggaatctgattgcaatattaagttacttgacagtcaaagtgaccagacctcc
aagctacgtttatctcatttctcaaaaaaagacacacctctaaggaacaaggttcctggg
ctatataagtccagttctgcagactctctttctacaaccaagatcaaacctctaggacct
gccagagccagtgggctgagcaagaagccggcaagcatccagaagagaaagcatcataat
gccgagaacaagccggggttacagatcaaactcaatgagctctggaaaaactttggattt
aaaaaagattctgaaaagcttcctccttgtaagaaacccctgtccccagtcagagataac
atccaactaactccagaagcggaagaggatatatttaacaaacctgaatgtggccgtgtt
caaagagcaatattccagtaa

DBGET integrated database retrieval system