KEGG   Homo sapiens (human): 91574Help
Entry
91574             CDS       T01001                                 

Gene name
C12orf65, COXPD7, SPG55
Definition
chromosome 12 open reading frame 65
Organism
hsa  Homo sapiens (human)
Disease
H00891  
Combined oxidative phosphorylation deficiency (COXPD)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.31
AA seq 166 aa AA seqDB search
MSTVGLFHFPTPLTRICPAPWGLRLWEKLTLLSPGIAVTPVQMAGKKDYPALLSLDENEL
EEQFVKGHGPGGQATNKTSNCVVLKHIPSGIVVKCHQTRSVDQNRKLARKILQEKVDVFY
NGENSPVHKEKREAAKKKQERKKRAKETLEKKKLLKELWESSKKVH
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgtgggtttatttcattttcctacaccactgacccgaatatgcccggcgcca
tggggactccggctttgggagaagctgacgttgttatccccaggaatagctgtcactccg
gtccagatggcaggcaagaaggactaccctgcactgctttccttggatgagaatgaactc
gaagagcagtttgtgaaaggacacggtccagggggccaggcaaccaacaaaaccagcaac
tgcgtggtgctgaagcacatcccctcaggcatcgttgtaaagtgccatcagacaagatca
gttgatcagaacagaaagctagctcggaaaatcctacaagagaaagtagatgttttctac
aatggtgaaaacagtcctgttcacaaagaaaaacgagaagcggcgaagaaaaaacaagaa
aggaaaaaaagagcaaaggaaaccctggaaaaaaagaagctacttaaagaactgtgggag
tcaagtaaaaaggtccactga

DBGET integrated database retrieval system