KEGG   Homo sapiens (human): 9162Help
Entry
9162              CDS       T01001                                 

Gene name
DGKI, DGK-IOTA
Definition
(RefSeq) diacylglycerol kinase iota
  KO
K00901  
diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Phospholipase D signaling pathway
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    9162 (DGKI)
   00564 Glycerophospholipid metabolism
    9162 (DGKI)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    9162 (DGKI)
   04072 Phospholipase D signaling pathway
    9162 (DGKI)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    9162 (DGKI)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     9162 (DGKI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O75912(Tbio)
UniProt: 
Position
7q33
AA seq 1065 aa AA seqDB search
MDAAGRGCHLLPLPAARGPARAPAAAAAAAASPPGPCSGAACAPSAAAGAGAMNPSSSAG
EEKGATGGSSSSGSGAGSCCLGAEGGADPRGAGSAAAAGAAALDEPAAAGQKEKDEALEE
KLRNLTFRKQVSYRKAISRAGLQHLAPAHPLSLPVANGPAKEPRATLDWSENAVNGEHLW
LETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREGG
SRSPRENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCF
MLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGMEQENK
GRPFVIKPISSPLMKPLLVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALEL
YRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDE
PVSKILCQVEDGTVVQLDRWNLHVERNPDLPPEELEDGVCKLPLNVFNNYFSLGFDAHVT
LEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQEL
KFQCIVFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGER
LHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLNDPQSV
PDRLRIRVNKISLQDYEGFHYDKEKLREASISDWLRTIAGELVQSFGAIPLGILVVRGDC
DLETCRMYIDRLQEDLQSVSSGSQRVHYQDHETSFPRALSAQRLSPRWCFLDDRSQEHLH
FVMEISQDEIFILDPDMVVSQPAGTPPGMPDLVVEQASGISDWWNPALRKRMLSDSGLGM
IAPYYEDSDLKDLSHSRVLQSPVSSEDHAILQAVIAGDLMKLIESYKNGGSLLIQGPDHC
SLLHYAAKTGNGEIVKYILDHGPSELLDMADSETGETALHKAACQRNRAVCQLLVDAGAS
LRKTDSKGKTPQERAQQAGDPDLAAYLESRQNYKVIGHEDLETAV
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgcgggaaggggctgccatttgctgcccctgccagcggcgcgcggacctgcc
cgcgctcctgcagccgccgccgccgccgccgccagcccgcccggcccctgcagcggcgcc
gcctgcgctccctccgcggccgccggagcgggcgccatgaaccccagctcctcggcggga
gaggagaaaggggcgacgggcggcagcagcagcagcggaagcggcgccgggagctgctgc
ctgggcgccgagggcggcgcggacccgcggggcgcagggtcagccgcggcggcgggggcc
gctgccctggacgagcccgcggccgccggccagaaggagaaggacgaagcgctggaggag
aagctgaggaacttaactttccggaagcaggtctcgtacaggaaagcaatctcccgggca
ggcctccagcatctggctcctgcacatcccctcagccttcctgtggcaaatggtccagcc
aaggagcccagagcgactttggactggagtgagaatgccgtgaatggagaacacctgtgg
ctggagaccaacgtctcgggagacctctgctaccttggagaggagaactgccaagtcaga
tttgcaaaatcagctctcaggaggaagtgtgcagtctgtaaaatcgtcgtccacaccgcc
tgcattgagcagctagaaaagattaatttcagatgtaaaccaacatttcgagaaggaggc
tcaaggtcaccaagagaaaattttgtacgtcatcactgggtgcacaggcgtcggcaggag
gggaaatgtaagcagtgtggtaagggcttccagcaaaagttctccttccacagtaaagag
attgtggctatcagctgttcctggtgcaagcaggcgtttcacaataaggtgacctgcttc
atgctgcatcacattgaagaaccctgctccctgggggctcatgctgctgttattgtcccg
cccacttggatcattaaggtgaagaaacctcagaactccctgaaggcttcaaatcggaag
aagaagagaacaagctttaaaagaaaagccagtaaaagagggatggaacaggaaaacaaa
ggtcgtccttttgtgataaaacccatctcttctcctctcatgaaacccttgcttgtattt
gtgaatcccaagagtggaggcaaccagggaaccaaagtcctgcagatgttcatgtggtac
ctgaatccacggcaagtctttgatctttctcaggaagggccaaaagatgcgcttgaattg
tataggaaagtaccaaatctgcgaattctggcctgtggtggggatggaacggtgggctgg
atcctttccatcctggatgaactgcagctgagccctcagcctcctgtgggggtccttcct
ctggggactgggaatgacctggctcgaactctcaactggggagggggctacactgatgaa
cctgtttctaagatcctgtgtcaagtggaagatgggacagttgtacagctagatcgctgg
aacctccatgtggaaagaaaccccgacttgcctccagaagaacttgaagatggcgtatgt
aagctccctctgaatgttttcaataactacttcagccttggatttgatgcccatgtcaca
ctggagttccatgaatccagagaagcaaatccagagaaattcaacagtcgttttcgaaat
aaaatgttctatgcaggggcagctttttctgacttcctacagagaagttctagagatcta
tccaaacatgttaaagttgtttgtgatggaacagatctcaccccaaagattcaggaactg
aagttccagtgtatagtatttttaaatatacccagatattgtgctggcacaatgccctgg
ggaaacccaggtgatcaccatgatttcgaacctcagcgtcatgatgatggttatattgaa
gtcattggatttaccatggcctctttggcagccctgcaagttgggggccatggagagagg
ctacaccagtgtcgagaagtcatgcttctaacttacaaatccatccccatgcaagtggat
ggggagccctgtaggttggccccagctatgattcggatctccctgaggaatcaggccaac
atggtacagaagagcaagaggagaacatccatgcctttactcaatgatccccagtctgtc
ccagatcgtctgaggatccgggtgaacaaaatcagtttacaagactatgaaggattccac
tatgacaaggagaaactccgagaagcttctatttcagactggttaagaaccattgctggg
gaactagtgcagtcatttggagcgatacctctgggtattctagttgtgcgtggagactgt
gatttggagacttgccgtatgtacatagaccgcctacaggaggacctacagtcagtttct
tctggctcccagagagttcattaccaggaccatgaaacctccttccccagggctctctca
gcacagaggctctctcctcggtggtgcttcctagatgacagatctcaggaacatttgcac
tttgtgatggagatttcccaagatgagatttttattctggacccagatatggtggtgtca
cagccggcggggacacctccgggcatgcctgacctggtggtggaacaagcctcggggatc
tcagactggtggaatcctgccctgcggaaacgcatgctgagtgacagtgggctggggatg
atagctccctattatgaggactcagatctgaaagatctcagccactcccgcgtgctacag
tcaccagtctcttcagaagatcatgcaattttgcaggcagtaatagctggtgatcttatg
aagctaatagaaagctataaaaatggaggcagtctgctaattcagggaccagaccactgt
tcactccttcactacgcagctaaaaccggcaacggggagattgtgaaatatatccttgac
cacggaccttccgagttattggatatggcagacagtgaaacgggtgagactgcactgcac
aaggctgcctgccagcggaaccgggctgtgtgccagcttctggtggatgcaggagcatct
ctgagaaagacggactccaagggtaagacacctcaagaaagagcacagcaggctggggac
ccagacttggctgcttacctagaaagccgtcagaactataaggtcattggccatgaggac
ctggaaactgctgtttga

DBGET integrated database retrieval system