KEGG   Homo sapiens (human): 91624Help
Entry
91624             CDS       T01001                                 

Gene name
NEXN, CMH20, NELIN
Definition
(RefSeq) nexilin (F actin binding protein)
Organism
hsa  Homo sapiens (human)
Disease
H00294  
Dilated cardiomyopathy (DCM)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p31.1
AA seq 675 aa AA seqDB search
MNDISQKAEILLSSSKPVPKTYVPKLGKGDVKDKFEAMQRAREERNQRRSRDEKQRRKEQ
YIREREWNRRKQEIKEMLASDDEEDVSSKVEKAYVPKLTGTVKGRFAEMEKQRQEEQRKR
TEEERKRRIEQDMLEKRKIQRELAKRAEQIEDINNTGTESASEEGDDSLLITVVPVKSYK
TSGKMKKNFEDLEKEREEKERIKYEEDKRIRYEEQRPSLKEAKCLSLVMDDEIESEAKKE
SLSPGKLKLTFEELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEDEENQDTAK
IFKGYRPGKLKLSFEEMERQRREDEKRKAEEEARRRIEEEKKAFAEARRNMVVDDDSPEM
YKTISQEFLTPGKLEINFEELLKQKMEEEKRRTEEERKHKLEMEKQEFEQLRQEMGEEEE
ENETFGLSREYEELIKLKRSGSIQAKNLKSKFEKIGQLSEKEIQKKIEEERARRRAIDLE
IKEREAENFHEEDDVDVRPARKSEAPFTHKVNMKARFEQMAKAREEEEQRRIEEQKLLRM
QFEQREIDAALQKKREEEEEEEGSIMNGSTAEDEEQTRSGAPWFKKPLKNTSVVDSEPVR
FTVKVTGEPKPEITWWFEGEILQDGEDYQYIERGETYCLYLPETFPEDGGEYMCKAVNNK
GSAASTCILTIESKN
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatatttcccaaaaggctgagattctgctttcttcatctaaacctgtcccaaaa
acctatgtaccaaaacttggcaagggtgatgtaaaggataagtttgaagccatgcagaga
gccagggaagaaagaaatcaaaggagatctagagacgaaaaacaaagaagaaaagaacaa
tatattagagagagagaatggaacaggagaaagcaggagattaaagaaatgcttgcttct
gatgatgaggaagatgtatcttctaaagtagaaaaggcttatgttccaaaattaacagga
actgtgaagggtagatttgctgaaatggagaaacaaagacaagaggaacaaaggaagaga
acggaggaggaacgaaaacgcagaattgagcaggatatgttagaaaagaggaaaatacag
cgtgaattagcaaaaagggctgaacagattgaggacataaacaatacgggaactgaatca
gcatcagaggaaggagatgattcactacttataactgtggtacctgtcaaatcatataaa
acatctggaaaaatgaaaaagaattttgaggatctagaaaaagaacgtgaagagaaagaa
aggatcaagtacgaggaagataaaagaataagatatgaagaacaacgaccatctctcaag
gaagcaaagtgtctttcattagttatggatgatgaaatagaaagtgaagcaaaaaaagaa
tcactttctcccggaaaattgaaactaacttttgaagaactggagcgacaaagacaagaa
aaccgaaagaagcaagctgaagaggaagcaagaaaacgtttagaagaagagaagcgtgct
tttgaagaagcaaggcggcaaatggtaaatgaagatgaggaaaaccaagacacagcaaaa
atttttaaagggtaccgccctggtaaactcaaactcagttttgaagaaatggaaaggcaa
agaagagaagatgaaaaaaggaaagcagaagaagaagccagaaggagaatagaggaagaa
aagaaggcgtttgctgaagcaaggagaaatatggtagtagatgatgactccccagagatg
tataagacaatctctcaagaatttcttacaccgggaaaactggaaattaattttgaagaa
ttattaaaacaaaaaatggaagaagaaaaacgacgaacagaggaggaacggaagcataag
ctagaaatggagaaacaagaatttgaacaactgagacaggaaatgggagaggaagaggaa
gaaaatgaaacctttggattgagcagagaatatgaagaactgatcaaattaaaaaggagt
ggctctattcaagctaaaaacctaaaaagcaagtttgaaaaaattggacagttgtctgaa
aaagaaatacagaaaaaaatagaagaagagcgagcaagaaggagagcaattgaccttgaa
attaaagagcgagaagctgaaaattttcatgaggaagatgatgttgatgttaggcctgca
agaaaaagcgaggctccatttactcacaaagtgaatatgaaagctagatttgaacaaatg
gctaaggcaagagaagaagaagaacaaagaagaattgaagaacaaaagttactacgcatg
cagtttgaacaaagggaaattgatgcagcactacaaaagaaaagagaagaggaggaggag
gaagaaggtagcatcatgaatggctccactgctgaagatgaagagcaaaccagatcagga
gctccatggttcaagaagcctcttaaaaacacatcagttgtagacagtgagccagtcaga
tttacggttaaagtaacaggagaacccaaaccagaaattacatggtggtttgaaggagaa
atactgcaggatggagaagactatcaatatattgaaaggggagaaacttactgcctttac
ttaccagaaactttcccagaagatggaggagagtatatgtgtaaagcagtcaacaataaa
ggatctgcagctagtacctgtattcttaccattgaaagtaagaattaa

DBGET integrated database retrieval system