KEGG   Homo sapiens (human): 91624Help
Entry
91624             CDS       T01001                                 

Gene name
NEXN, CMH20, NELIN
Definition
(RefSeq) nexilin F-actin binding protein
Organism
hsa  Homo sapiens (human)
Disease
H00294  
Dilated cardiomyopathy (DCM)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p31.1
AA seq 675 aa AA seqDB search
MNDISQKAEILLSSSKPVPKTYVPKLGKGDVKDKFEAMQRAREERNQRRSRDEKQRRKEQ
YIREREWNRRKQEIKEMLASDDEEDVSSKVEKAYVPKLTGTVKGRFAEMEKQRQEEQRKR
TEEERKRRIEQDMLEKRKIQRELAKRAEQIEDINNTGTESASEEGDDSLLITVVPVKSYK
TSGKMKKNFEDLEKEREEKERIKYEEDKRIRYEEQRPSLKEAKCLSLVMDDEIESEAKKE
SLSPGKLKLTFEELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEDEENQDTAK
IFKGYRPGKLKLSFEEMERQRREDEKRKAEEEARRRIEEEKKAFAEARRNMVVDDDSPEM
YKTISQEFLTPGKLEINFEELLKQKMEEEKRRTEEERKHKLEMEKQEFEQLRQEMGEEEE
ENETFGLSREYEELIKLKRSGSIQAKNLKSKFEKIGQLSEKEIQKKIEEERARRRAIDLE
IKEREAENFHEEDDVDVRPARKSEAPFTHKVNMKARFEQMAKAREEEEQRRIEEQKLLRM
QFEQREIDAALQKKREEEEEEEGSIMNGSTAEDEEQTRSGAPWFKKPLKNTSVVDSEPVR
FTVKVTGEPKPEITWWFEGEILQDGEDYQYIERGETYCLYLPETFPEDGGEYMCKAVNNK
GSAASTCILTIESKN
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatatttcccaaaaggctgagattctgctttcttcatctaaacctgtcccaaaa
acctatgtaccaaaacttggcaagggtgatgtaaaggataagtttgaagccatgcagaga
gccagggaagaaagaaatcaaaggagatctagagacgaaaaacaaagaagaaaagaacaa
tatattagagagagagaatggaacaggagaaagcaggagattaaagaaatgcttgcttct
gatgatgaggaagatgtatcttctaaagtagaaaaggcttatgttccaaaattaacagga
actgtgaagggtagatttgctgaaatggagaaacaaagacaagaggaacaaaggaagaga
acggaggaggaacgaaaacgcagaattgagcaggatatgttagaaaagaggaaaatacag
cgtgaattagcaaaaagggctgaacagattgaggacataaacaatacgggaactgaatca
gcatcagaggaaggagatgattcactacttataactgtggtacctgtcaaatcatataaa
acatctggaaaaatgaaaaagaattttgaggatctagaaaaagaacgtgaagagaaagaa
aggatcaagtacgaggaagataaaagaataagatatgaagaacaacgaccatctctcaag
gaagcaaagtgtctttcattagttatggatgatgaaatagaaagtgaagcaaaaaaagaa
tcactttctcccggaaaattgaaactaacttttgaagaactggagcgacaaagacaagaa
aaccgaaagaagcaagctgaagaggaagcaagaaaacgtttagaagaagagaagcgtgct
tttgaagaagcaaggcggcaaatggtaaatgaagatgaggaaaaccaagacacagcaaaa
atttttaaagggtaccgccctggtaaactcaaactcagttttgaagaaatggaaaggcaa
agaagagaagatgaaaaaaggaaagcagaagaagaagccagaaggagaatagaggaagaa
aagaaggcgtttgctgaagcaaggagaaatatggtagtagatgatgactccccagagatg
tataagacaatctctcaagaatttcttacaccgggaaaactggaaattaattttgaagaa
ttattaaaacaaaaaatggaagaagaaaaacgacgaacagaggaggaacggaagcataag
ctagaaatggagaaacaagaatttgaacaactgagacaggaaatgggagaggaagaggaa
gaaaatgaaacctttggattgagcagagaatatgaagaactgatcaaattaaaaaggagt
ggctctattcaagctaaaaacctaaaaagcaagtttgaaaaaattggacagttgtctgaa
aaagaaatacagaaaaaaatagaagaagagcgagcaagaaggagagcaattgaccttgaa
attaaagagcgagaagctgaaaattttcatgaggaagatgatgttgatgttaggcctgca
agaaaaagcgaggctccatttactcacaaagtgaatatgaaagctagatttgaacaaatg
gctaaggcaagagaagaagaagaacaaagaagaattgaagaacaaaagttactacgcatg
cagtttgaacaaagggaaattgatgcagcactacaaaagaaaagagaagaggaggaggag
gaagaaggtagcatcatgaatggctccactgctgaagatgaagagcaaaccagatcagga
gctccatggttcaagaagcctcttaaaaacacatcagttgtagacagtgagccagtcaga
tttacggttaaagtaacaggagaacccaaaccagaaattacatggtggtttgaaggagaa
atactgcaggatggagaagactatcaatatattgaaaggggagaaacttactgcctttac
ttaccagaaactttcccagaagatggaggagagtatatgtgtaaagcagtcaacaataaa
ggatctgcagctagtacctgtattcttaccattgaaagtaagaattaa

DBGET integrated database retrieval system