KEGG   Homo sapiens (human): 9167Help
Entry
9167              CDS       T01001                                 

Gene name
COX7A2L, COX7AR, COX7RP, EB1, SIG81
Definition
cytochrome c oxidase subunit VIIa polypeptide 2 like
Orthology
K02270  
cytochrome c oxidase subunit 7a
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    9167 (COX7A2L)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    9167 (COX7A2L)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    9167 (COX7A2L)
   05012 Parkinson's disease
    9167 (COX7A2L)
   05016 Huntington's disease
    9167 (COX7A2L)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    9167 (COX7A2L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
2p21
AA seq 114 aa AA seqDB search
MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKV
PELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgtactacaagtttagtggcttcacgcagaagttggcaggagcatgggcttcggaggcc
tatagcccgcagggattaaagcctgtggtttccacagaagcaccacctatcatatttgcc
acaccaactaaactgacctccgattccacagtgtatgattatgctgggaaaaacaaagtt
ccagagctacaaaagtttttccagaaagctgatggtgtgcccgtctacctgaaacgaggc
ctgcctgaccaaatgctttaccggaccaccatggcgctgactgtgggagggaccatctac
tgcctgatcgccctctacatggcttcgcagcccaaaaacaaatga

DBGET integrated database retrieval system