KEGG   Homo sapiens (human): 9170Help
Entry
9170              CDS       T01001                                 

Gene name
LPAR2, EDG-4, EDG4, LPA-2, LPA2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  
lysophosphatidic acid receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    9170 (LPAR2)
   04072 Phospholipase D signaling pathway
    9170 (LPAR2)
   04151 PI3K-Akt signaling pathway
    9170 (LPAR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9170 (LPAR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    9170 (LPAR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Lysophosphatidic acid [OT]
    9170 (LPAR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
19p12
AA seq 351 aa AA seqDB search
MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA
TLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR
MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA
EMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcatgggccagtgctactacaacgagaccatcggcttcttctataacaacagt
ggcaaagagctcagctcccactggcggcccaaggatgtggtcgtggtggcactggggctg
accgtcagcgtgctggtgctgctgaccaatctgctggtcatagcagccatcgcctccaac
cgccgcttccaccagcccatctactacctgctcggcaatctggccgcggctgacctcttc
gcgggcgtggcctacctcttcctcatgttccacactggtccccgcacagcccgactttca
cttgagggctggttcctgcggcagggcttgctggacacaagcctcactgcgtcggtggcc
acactgctggccatcgccgtggagcggcaccgcagtgtgatggccgtgcagctgcacagc
cgcctgccccgtggccgcgtggtcatgctcattgtgggcgtgtgggtggctgccctgggc
ctggggctgctgcctgcccactcctggcactgcctctgtgccctggaccgctgctcacgc
atggcacccctgctcagccgctcctatttggccgtctgggctctgtcgagcctgcttgtc
ttcctgctcatggtggctgtgtacacccgcattttcttctacgtgcggcggcgagtgcag
cgcatggcagagcatgtcagctgccacccccgctaccgagagaccacgctcagcctggtc
aagactgttgtcatcatcctgggggcgttcgtggtctgctggacaccaggccaggtggta
ctgctcctggatggtttaggctgtgagtcctgcaatgtcctggctgtagaaaagtacttc
ctactgttggccgaggccaactcactggtcaatgctgctgtgtactcttgccgagatgct
gagatgcgccgcaccttccgccgccttctctgctgcgcgtgcctccgccagtccacccgc
gagtctgtccactatacatcctctgcccagggaggtgccagcactcgcatcatgcttccc
gagaacggccacccactgatggactccaccctttag

DBGET integrated database retrieval system