KEGG   Homo sapiens (human): 9177Help
Entry
9177              CDS       T01001                                 

Gene name
HTR3B, 5-HT3B
Definition
(RefSeq) 5-hydroxytryptamine receptor 3B
  KO
K04819  
5-hydroxytryptamine receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
Serotonergic synapse
Taste transduction
Drug target
Alosetron [DG:DG00046]: 
Cilansetron [DG:DG00047]: 
Metoclopramide [DG:DG00055]: 
Ondansetron [DG:DG00060]: 
Granisetron [DG:DG00061]: 
Tropisetron [DG:DG00062]: 
Dolasetron [DG:DG00063]: 
Palonosetron [DG:DG00064]: 
Metergoline: 
Mirtazapine: 
Vortioxetine [DG:DG00965]: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    9177 (HTR3B)
  Sensory system
   04742 Taste transduction
    9177 (HTR3B)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Serotonin (5-HT3)
   9177 (HTR3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q23.1
AA seq 441 aa AA seqDB search
MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVY
LDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIII
NEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTV
EDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPL
VYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTP
LIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRA
VVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSY
LFMLGIYTITLCSLWALWGGV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcaagtgtaatggctcccctgtgggcctgcatcctggtggctgcaggaattcta
gccacagatacacatcatccccaggattctgctctgtatcatctcagcaagcagctatta
cagaaatatcataaagaagtgagacctgtttacaactggaccaaggccaccacagtctac
ctggacctgttcgtccatgctatattggatgtggatgcagagaatcaaatattaaagaca
agtgtatggtaccaagaggtctggaatgatgaatttttatcctggaactccagcatgttt
gatgagattagagagatctccctacctctaagtgccatctgggcccccgatatcatcatc
aatgagtttgtggacattgaaagataccctgaccttccctatgtttatgtgaactcatct
gggaccattgagaactataagcccatccaggtggtctctgcgtgcagtttagagacatat
gcttttccatttgatgtccagaattgcagcctgaccttcaagagcattctgcatacagtg
gaagacgtagacctggcctttctgaggagcccagaagacattcagcatgacaaaaaggcg
tttttgaatgacagtgagtgggaacttctatctgtgtcctccacatacagcatcctgcag
agcagcgctggaggatttgcacagattcagtttaatgtggtgatgcgcaggcaccccctg
gtctatgtcgtgagtctgctgattcctagcatctttctcatgctggtggacctggggagc
ttctacctgccacccaactgccgagccaggattgtgttcaagaccagtgtgctggtgggc
tacaccgtcttcagggtcaacatgtccaaccaggtgccacggagtgtagggagcacccct
ctgattgggcacttcttcaccatctgcatggccttcttggttctcagcttagctaagtcc
atcgtgttggtcaaattcctccatgatgagcagcgtggtggacaggagcagcccttcttg
tgccttcgaggggacaccgatgctgacaggcctagagtggaacccagggcccaacgtgct
gtggtaacagagtcctcgctgtatggagagcacctggcccagccaggaaccctgaaggaa
gtctggtcgcagcttcaatctatcagcaactacctccaaactcaggaccagacagaccaa
caggaggcagagtggctggtcctcctgtcccgctttgaccgactgctcttccaaagctac
cttttcatgctggggatctacaccatcactctgtgctccctctgggcactgtggggcggc
gtgtga

DBGET integrated database retrieval system