KEGG   Homo sapiens (human): 91782Help
Entry
91782             CDS       T01001                                 

Gene name
CHMP7
Definition
charged multivesicular body protein 7
Orthology
K15053  
charged multivesicular body protein 7
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Module
ESCRT-III complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    91782 (CHMP7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   91782 (CHMP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p21.3
AA seq 453 aa AA seqDB search
MWSPEREAEAPAGGDPAGLLPPEWEEDEERMSFLFSAFKRSREVNSTDWDSKMGFWAPLV
LSHSRRQGVVRLRLRDLQEAFQRKGSVPLGLATVLQDLLRRGELQRESDFMASVDSSWIS
WGVGVFLLKPLKWTLSNMLGDNKVPAEEVLVAVELLKEKAEEVYRLYQNSPLSSHPVVAL
SELSTLCANSCPDERTFYLVLLQLQKEKRVTVLEQNGEKIVKFARGPRAKVSPVNDVDVG
VYQLMQSEQLLSRKVESLSQEAERCKEEARRACRAGKKQLALRSLKAKQRTEKRIEALHA
KLDTVQGILDRIYASQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVDQIQELCDTQDE
VSQTLAGGVTNGLDFDSEELEKELDILLQDTTKEPLDLPDNPRNRHFTNSVPNPRISDAE
LEAELEKLSLSEGGLVPSSKSPKRQLEPTLKPL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtggtccccggagcgggaggccgaggccccagccgggggagacccggcgggccttctg
ccccccgagtgggaggaggacgaggagcgcatgtccttcctgttctccgctttcaagagg
agtcgcgaggtgaacagcaccgactgggacagcaagatgggcttctgggcgccgttggtg
ctgagccacagccgccgccagggggtggtgcgcctgcgtctgcgggacttgcaggaggcc
tttcagcgcaaggggagcgtcccgctggggctggccacggtgctgcaggacctgctgcgt
cgaggggagctgcagcgggagtcagacttcatggccagtgtagacagcagctggatctcc
tggggggttggggtcttcctgctgaagcctctcaagtggactctttctaacatgctggga
gataataaggttccagctgaggaggtccttgtcgctgtggagctgttgaaggaaaaggct
gaggaggtgtatcgtctgtatcagaactcgcccctctcctcccaccccgtggtggccctg
tcagagctcagcaccctctgtgctaactcctgcccagatgagaggaccttctacttggtg
ttgctgcagctgcagaaggagaagagggtcacagtcctcgagcagaacggggagaagatt
gtgaagtttgcccgagggccacgtgccaaggtctctccagtcaatgacgtagatgttggg
gtgtaccagctgatgcagagtgaacagcttctctcacgcaaagtggagtccttatcccag
gaagcagagaggtgtaaagaagaagcccgccgggcatgccgagcaggaaagaagcagctg
gcactgaggtctctcaaggccaagcaacggacagagaagcgcatcgaggccttgcatgcc
aagctggacactgttcaaggcatcctggaccggatctatgcctcccagacagatcagatg
gtttttaacgcctaccaggctggggtaggagcactcaaactctccatgaaggatgtcaca
gtggagaaggcagagagcctcgtggatcagatccaagagctctgtgacacccaggatgaa
gtttctcagactctggctggtggggtaacaaatggcttagattttgacagtgaagaactg
gagaaggaattggacatcctccttcaggataccaccaaagaacctttggatctgcctgac
aacccccgcaataggcattttaccaacagcgtgcctaaccctaggatctcagatgctgaa
cttgaagctgaacttgagaaactgtccttatcagagggaggtttggtcccaagcagtaaa
tctccaaaaaggcaattggaaccgactctaaagccattgtag

DBGET integrated database retrieval system