KEGG   Homo sapiens (human): 91782Help
Entry
91782             CDS       T01001                                 

Gene name
CHMP7
Definition
(RefSeq) charged multivesicular body protein 7
  KO
K15053  charged multivesicular body protein 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Module
hsa_M00412  ESCRT-III complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    91782 (CHMP7)
  Cell growth and death
   04217 Necroptosis
    91782 (CHMP7)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    91782 (CHMP7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   91782 (CHMP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 PspA_IM30 LPP FLYWCH_u Zea_mays_MuDR FapA Snapin_Pallidin Fez1
Motif
Other DBs
NCBI-GeneID: 91782
NCBI-ProteinID: NP_689485
OMIM: 611130
HGNC: 28439
Ensembl: ENSG00000147457
Vega: OTTHUMG00000131785
Pharos: Q8WUX9(Tbio)
UniProt: Q8WUX9 B3KUH0
Position
8p21.3
AA seq 453 aa AA seqDB search
MWSPEREAEAPAGGDPAGLLPPEWEEDEERMSFLFSAFKRSREVNSTDWDSKMGFWAPLV
LSHSRRQGVVRLRLRDLQEAFQRKGSVPLGLATVLQDLLRRGELQRESDFMASVDSSWIS
WGVGVFLLKPLKWTLSNMLGDNKVPAEEVLVAVELLKEKAEEVYRLYQNSPLSSHPVVAL
SELSTLCANSCPDERTFYLVLLQLQKEKRVTVLEQNGEKIVKFARGPRAKVSPVNDVDVG
VYQLMQSEQLLSRKVESLSQEAERCKEEARRACRAGKKQLALRSLKAKQRTEKRIEALHA
KLDTVQGILDRIYASQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVDQIQELCDTQDE
VSQTLAGGVTNGLDFDSEELEKELDILLQDTTKEPLDLPDNPRNRHFTNSVPNPRISDAE
LEAELEKLSLSEGGLVPSSKSPKRQLEPTLKPL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtggtccccggagcgggaggccgaggccccagccgggggagacccggcgggccttctg
ccccccgagtgggaggaggacgaggagcgcatgtccttcctgttctccgctttcaagagg
agtcgcgaggtgaacagcaccgactgggacagcaagatgggcttctgggcgccgttggtg
ctgagccacagccgccgccagggggtggtgcgcctgcgtctgcgggacttgcaggaggcc
tttcagcgcaaggggagcgtcccgctggggctggccacggtgctgcaggacctgctgcgt
cgaggggagctgcagcgggagtcagacttcatggccagtgtagacagcagctggatctcc
tggggggttggggtcttcctgctgaagcctctcaagtggactctttctaacatgctggga
gataataaggttccagctgaggaggtccttgtcgctgtggagctgttgaaggaaaaggct
gaggaggtgtatcgtctgtatcagaactcgcccctctcctcccaccccgtggtggccctg
tcagagctcagcaccctctgtgctaactcctgcccagatgagaggaccttctacttggtg
ttgctgcagctgcagaaggagaagagggtcacagtcctcgagcagaacggggagaagatt
gtgaagtttgcccgagggccacgtgccaaggtctctccagtcaatgacgtagatgttggg
gtgtaccagctgatgcagagtgaacagcttctctcacgcaaagtggagtccttatcccag
gaagcagagaggtgtaaagaagaagcccgccgggcatgccgagcaggaaagaagcagctg
gcactgaggtctctcaaggccaagcaacggacagagaagcgcatcgaggccttgcatgcc
aagctggacactgttcaaggcatcctggaccggatctatgcctcccagacagatcagatg
gtttttaacgcctaccaggctggggtaggagcactcaaactctccatgaaggatgtcaca
gtggagaaggcagagagcctcgtggatcagatccaagagctctgtgacacccaggatgaa
gtttctcagactctggctggtggggtaacaaatggcttagattttgacagtgaagaactg
gagaaggaattggacatcctccttcaggataccaccaaagaacctttggatctgcctgac
aacccccgcaataggcattttaccaacagcgtgcctaaccctaggatctcagatgctgaa
cttgaagctgaacttgagaaactgtccttatcagagggaggtttggtcccaagcagtaaa
tctccaaaaaggcaattggaaccgactctaaagccattgtag

DBGET integrated database retrieval system