KEGG   Homo sapiens (human): 9179Help
Entry
9179              CDS       T01001                                 

Gene name
AP4M1, CPSQ3, MU-4, MU-ARP2, SPG50
Definition
adaptor-related protein complex 4, mu 1 subunit
Orthology
K12402  
AP-4 complex subunit mu-1
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Disease
H01097  
Cerebral palsy
Class
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q22.1
AA seq 453 aa AA seqDB search
MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGDESPVVMHHHGRHFIHIR
HSGLYLVVTTSENVSPFSLLELLSRLATLLGDYCGSLGEGTISRNVALVYELLDEVLDYG
YVQTTSTEMLRNFIQTEAVVSKPFSLFDLSSVGLFGAETQQSKVAPSSAASRPVLSSRSD
QSQKNEVFLDVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSE
LRGYGPGIRVDEVSFHSSVNLDEFESHRILRLQPPQGELTVMRYQLSDDLPSPLPFRLFP
SVQWDRGSGRLQVYLKLRCDLLSKSQALNVRLHLPLPRGVVSLSQELSSPEQKAELAEGA
LRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQ
VRFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgatttcccaattcttcattctgtcctccaagggggacccgctcatctacaaagacttc
cgcggggacagtggcggccgggatgtggccgagctcttctaccggaagctgacgggactg
ccaggagacgagtccccggttgtcatgcatcaccatggccgtcatttcattcacatcaga
cacagcggcctctatttggtggtcacaacttcagaaaacgtttctcccttcagcctccta
gaactgctctccaggttggccacccttctgggcgattactgtggctccctgggcgagggg
accatctcccgcaatgtggctctggtatacgaactcctggatgaagtgctggactatggc
tatgtacagaccacatccacggagatgctgaggaatttcatccagacggaagctgtggtc
agcaagcccttcagcctctttgacctcagcagcgttggcttgtttggggctgagacacaa
cagagcaaagtggcccccagcagtgcagccagccgccccgtcctgtccagtcgctctgac
cagagccaaaagaatgaagtttttttggatgtggtcgagagattgtctgtactgatagca
tctaatggatccctgctgaaggtggatgtgcagggagagattcggctcaagagcttcctt
cctagcggctctgagatgcgcattggcttgacggaagagttttgtgtggggaagtcagag
ctgagaggttatgggccaggaatccgggtcgatgaagtctcgtttcacagctctgtgaat
ctggacgaatttgagtctcatcgaatcctccgcttgcaaccacctcagggcgagctgact
gtgatgcggtaccaactctccgatgacctcccctcaccgctccccttccggctcttcccc
tctgtgcagtgggaccgaggctcaggccggctccaggtttatctaaagttgcgatgtgac
ctgctctcaaagagccaagccctcaatgtcaggctgcacctccccctgcctcgaggggtg
gtcagcctgtctcaggagctgagcagcccagagcagaaggctgagctggcagagggagcc
cttcgctgggacctgcctcgggtgcaaggaggctctcaactctcaggccttttccagatg
gacgtcccagggcccccaggacctcccagccatgggctctccacctcggcctctcctctg
gggctgggccctgccagtctctccttcgagcttccccggcacacgtgctctggcctccag
gtccgattcctcaggctggccttcaggccatgcggcaatgccaacccccacaagtgggtg
cgacacctaagccacagcgacgcctatgtcattcggatctga

DBGET integrated database retrieval system