KEGG   Homo sapiens (human): 9180Help
Entry
9180              CDS       T01001                                 

Gene name
OSMR, OSMRB, PLCA1
Definition
oncostatin M receptor
Orthology
K05057  
oncostatin M receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Disease
H01217  
Primary localized cutaneous amyloidosis (PLCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    9180 (OSMR)
   04151 PI3K-Akt signaling pathway
    9180 (OSMR)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9180 (OSMR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p13.1
AA seq 342 aa AA seqDB search
MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYH
QELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDD
AKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCY
LEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEP
KDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQ
DSQETYNFTLIAENYLRKRSVNILFNLTHRGETRVVTAHRGH
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggctctatttgcagtctttcagacaacattcttcttaacattgctgtccttgaggact
taccagagtgaagtcttggctgaacgtttaccattgactcctgtatcacttaaagtttcc
accaattctacgcgtcagagtttgcacttacaatggactgtccacaaccttccttatcat
caggaattgaaaatggtatttcagatccagatcagtaggattgaaacatccaatgtcatc
tgggtggggaattacagcaccactgtgaagtggaaccaggttctgcattggagctgggaa
tctgagctccctttggaatgtgccacacactttgtaagaataaagagtttggtggacgat
gccaagttccctgagccaaatttctggagcaactggagttcctgggaggaagtcagtgta
caagattctactggacaggatatattgttcgttttccctaaagataagctggtggaagaa
ggcaccaatgttaccatttgttacgtttctaggaacattcaaaataatgtatcctgttat
ttggaagggaaacagattcatggagaacaacttgatccacatgtaactgcattcaacttg
aatagtgtgcctttcattaggaataaagggacaaatatctattgtgaggcaagtcaagga
aatgtcagtgaaggcatgaaaggcatcgttctttttgtctcaaaagtacttgaggagccc
aaggacttttcttgtgaaaccgaggacttcaagactttgcactgtacttgggatcctggg
acggacactgccttggggtggtctaaacaaccttcccaaagctacactttatttgaatca
ttttctggggaaaagaaactttgtacacacaaaaactggtgtaattggcaaataactcaa
gactcacaagaaacctataacttcacactcatagctgaaaattacttaaggaagagaagt
gtcaatatcctttttaacctgactcatcgaggtgagactagagttgtcacagcccaccgt
ggccactaa

DBGET integrated database retrieval system